alpha-Actinin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: alpha-Actinin 1 Antibody [NBP1-85791] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Western Blot: alpha-Actinin 1 Antibody [NBP1-85791] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Analysis in human cell lines A-431 and HEK293 using Anti-ACTN1 antibody. Corresponding ACTN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

• Reactivity: Hu, Mu, Rt, Ca
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha-Actinin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV
• Marker: Z-disk Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACTN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261). Canine reactivity per customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for alpha-Actinin 1 Antibody - BSA Free

• actinin 1 smooth muscle
• actinin, alpha 1
• ACTN1
• alpha Actinin 1
• alphaActinin 1
• alpha-Actinin 1
• Alpha-actinin cytoskeletal isoform
• alpha-actinin-1
• BDPLT15
• F-actin cross-linking protein
• FLJ40884
• FLJ54432
• Non-muscle alpha-actinin-1

Background

Alpha Actinin is an actin binding protein present in both muscle and non-muscle cells. It has a molecular weight of 100,000 daltons and forms dimers in solution. In normal skeletal muscle alpha actinin is associated with the z-discs that define muscle sarcomeres. In smooth muscle alpha actinin has been detected in dense bodies and plaques characteristic of the tissue. Immunofluorescent labeling of a large variety of cells using antibody to alpha actinin reveals extensive association of the proteins with actin containing stress fibers and in particular with their membrane bound termini.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha-Actinin 1 Antibody (NBP1-85791)(1)

Publication using NBP1-85791

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Reviews for alpha-Actinin 1 Antibody (NBP1-85791) (2)

Average Rating: 3

(Based on 2 reviews)

reviewed by: Verified Customer WB 08/28/2014

Summary

• Application: Western Blot

reviewed by: Verified Customer WB 08/28/2014

Summary

• Application: Western Blot

FAQs for alpha-Actinin 1 Antibody (NBP1-85791). (Showing 1 - 1 of 1 FAQ).

1. Is this item restricted under "Cartagena Law"?
   • To our knowledge this item is not restricted under the Cartagena Protocol, but this antibody is RUO. We have not tested or certified this product for use in vivo or for diagnostic use. Any use of this kind is undertaken by the end user at their own risk.

Bioinformatics

• Gene Symbol: ACTN1