alpha-Actinin 1 Antibody

Images

 
Western Blot: alpha-Actinin 1 Antibody [NBP1-85791] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate ...read more
Immunohistochemistry-Paraffin: alpha-Actinin 1 Antibody [NBP1-85791] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: alpha-Actinin 1 Antibody [NBP1-85791] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, CaSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-Actinin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV
Marker
Z-disk Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alpha-Actinin 1 Recombinant Protein Antigen (NBP1-85791PEP)
Reviewed Applications
Read 2 Reviews rated 3
using
NBP1-85791 in the following applications:

Publications
Read Publication using NBP1-85791.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-Actinin 1 Antibody

  • actinin 1 smooth muscle
  • actinin, alpha 1
  • ACTN1
  • alphaActinin 1
  • alpha-Actinin 1
  • Alpha-actinin cytoskeletal isoform
  • alpha-actinin-1
  • BDPLT15
  • F-actin cross-linking protein
  • FLJ40884
  • FLJ54432
  • Non-muscle alpha-actinin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009124-D01P
Species: Hu
Applications: WB, ELISA
796-IC
Species: Mu
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF

Publications for alpha-Actinin 1 Antibody (NBP1-85791)(1)

Reviews for alpha-Actinin 1 Antibody (NBP1-85791) (2) 32

Average Rating: 3
(Based on 2 reviews)
We have 2 reviews tested in 1 application: WB.

Reviews using NBP1-85791:
Filter by Applications
WB
(2)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot alpha-Actinin 1 NBP1-85791
Enlarge
reviewed by:
Anonymous
WB 08/28/2014
View

Summary

ApplicationWestern Blot
CommentsSimilarly to my findings when probing against actin, in multiple species (mouse and dog), double banding appears at in tissues dense with actin. I've found that, when probing against actin, decreasing primary antibody concentration in these samples reduces, and can eliminate the non-specific band. Took a lot of troubleshooting to find the sweet spot, and I have yet to go through that process with this alpha actinin antibody.
Western Blot alpha-Actinin 1 NBP1-85791
Enlarge
reviewed by:
Anonymous
WB 08/28/2014
View

Summary

ApplicationWestern Blot
CommentsI have found that anti-actin and actinin antibodies tend to produce a double band, especially in tissues where actin is present in high amounts. I've found that decreasing primary antibody concentration when probing for actin (1:10000), reduces this background band, but have yet to test that for this antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Actinin 1 Antibody (NBP1-85791). (Showing 1 - 1 of 1 FAQ).

  1. Is this item restricted under "Cartagena Law"?
    • To our knowledge this item is not restricted under the Cartagena Protocol, but this antibody is RUO. We have not tested or certified this product for use in vivo or for diagnostic use. Any use of this kind is undertaken by the end user at their own risk.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Actinin 1 Products

Bioinformatics Tool for alpha-Actinin 1 Antibody (NBP1-85791)

Discover related pathways, diseases and genes to alpha-Actinin 1 Antibody (NBP1-85791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Actinin 1 Antibody (NBP1-85791)

Discover more about diseases related to alpha-Actinin 1 Antibody (NBP1-85791).
 

Pathways for alpha-Actinin 1 Antibody (NBP1-85791)

View related products by pathway.

PTMs for alpha-Actinin 1 Antibody (NBP1-85791)

Learn more about PTMs related to alpha-Actinin 1 Antibody (NBP1-85791).
 

Research Areas for alpha-Actinin 1 Antibody (NBP1-85791)

Find related products by research area.

Blogs on alpha-Actinin 1

There are no specific blogs for alpha-Actinin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
2
2
0
1
0

Anonymous
08/28/2014
Application: WB
Species:

Anonymous
08/28/2014
Application: WB
Species:

Bioinformatics

Gene Symbol ACTN1
Entrez