PDLIM1 Antibody

Images

 
Western Blot: PDLIM1 Antibody [NBP1-84443] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: PDLIM1 Antibody [NBP1-84443] - Staining of human pancreas shows strong positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDLIM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDLIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDLIM1 Protein (NBP1-84443PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDLIM1 Antibody

  • CLIM1carboxyl terminal LIM domain protein 1
  • CLP-36
  • CLP36carboxy terminal LIM domain protein 1
  • C-terminal LIM domain protein 1
  • elfin
  • enigma
  • hCLIM1
  • LIM domain protein CLP-36
  • PDZ and LIM domain 1 (elfin)
  • PDZ and LIM domain 1
  • PDZ and LIM domain protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00619
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80952
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PDLIM1 Antibody (NBP1-84443) (0)

There are no publications for PDLIM1 Antibody (NBP1-84443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDLIM1 Antibody (NBP1-84443) (0)

There are no reviews for PDLIM1 Antibody (NBP1-84443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDLIM1 Antibody (NBP1-84443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDLIM1 Products

Bioinformatics Tool for PDLIM1 Antibody (NBP1-84443)

Discover related pathways, diseases and genes to PDLIM1 Antibody (NBP1-84443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDLIM1 Antibody (NBP1-84443)

Discover more about diseases related to PDLIM1 Antibody (NBP1-84443).
 

Pathways for PDLIM1 Antibody (NBP1-84443)

View related products by pathway.

PTMs for PDLIM1 Antibody (NBP1-84443)

Learn more about PTMs related to PDLIM1 Antibody (NBP1-84443).

Blogs on PDLIM1

There are no specific blogs for PDLIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDLIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDLIM1