PDLIM1 Antibody

Images

 
Western Blot: PDLIM1 Antibody [NBP1-84443] - Analysis in human cell line CACO-2 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: PDLIM1 Antibody [NBP1-84443] - Staining of human Placenta shows strong cytoplasmic positivity in decidual cells.
Immunohistochemistry-Paraffin: PDLIM1 Antibody [NBP1-84443] - Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: PDLIM1 Antibody [NBP1-84443] - Staining of human Pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: PDLIM1 Antibody [NBP1-84443] - Staining of human Small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDLIM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFFVEDQIYCEKHARERVTPPEGYEVVTV
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDLIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDLIM1 Protein (NBP1-84443PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDLIM1 Antibody

  • CLIM1carboxyl terminal LIM domain protein 1
  • CLP-36
  • CLP36carboxy terminal LIM domain protein 1
  • C-terminal LIM domain protein 1
  • elfin
  • enigma
  • hCLIM1
  • LIM domain protein CLP-36
  • PDZ and LIM domain 1 (elfin)
  • PDZ and LIM domain 1
  • PDZ and LIM domain protein 1

Background

CLP36 is a PDZ-domain and LIM-domain containing protein that associates with actin filaments and stress fibers via alpha-actinin. CLP36 has been show to be critical to stress fiber formation and focal adhesions. Alternative names for CLP36 include Elfin, C-terminal LIM domain protein 1, PDZ and LIM domain protein 1, CLIM1, and PDLIM1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80833
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: IHC, IP, WB
NBP3-23662
Species: Hu
Applications: Flow, ICC/IF, IHC-P
H00011155-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, KD, WB
NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-84841
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89549
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00619
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00748
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-48251
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-80953
Species: Hu
Applications: IHC, IHC-P

Publications for PDLIM1 Antibody (NBP1-84443) (0)

There are no publications for PDLIM1 Antibody (NBP1-84443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDLIM1 Antibody (NBP1-84443) (0)

There are no reviews for PDLIM1 Antibody (NBP1-84443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDLIM1 Antibody (NBP1-84443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDLIM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDLIM1