Aldolase A Antibody (4B2E5)

Western Blot: Aldolase A Antibody (4B2E5) [NBP3-15381] - Western blot analysis of extracts of various cell lines, using Aldolase A Rabbit mAb (NBP3-15381) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry-Paraffin: Aldolase A Antibody (4B2E5) [NBP3-15381] -Analysis of paraffin-embedded Rat colon tissue using ALDOA Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer( pH 9.0) prior to IHC staining.

Immunohistochemistry: Aldolase A Antibody (4B2E5) [Aldolase A] - Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using Aldolase A Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry: Aldolase A Antibody (4B2E5) [Aldolase A] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Aldolase A Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 4B2E5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aldolase A Antibody (4B2E5) Summary

• Description: Novus Biologicals Rabbit Aldolase A Antibody (4B2E5) (NBP3-15381) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aldolase (P04075). MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ALDOA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:800
  • Immunohistochemistry-Paraffin 1:200 - 1:800
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aldolase A Antibody (4B2E5)

• ALDA
• aldolase A, fructose-bisphosphate
• EC 4.1.2.13
• fructose-1,6-bisphosphate triosephosphate-lyase
• fructose-bisphosphate aldolase A
• GSD12
• Lung cancer antigen NY-LU-1
• MGC10942
• MGC17716
• MGC17767
• Muscle-type aldolase

Background

Aldolase A (fructose bisphosphate aldolase) is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3 phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants which encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALDOA