SPINK1 Antibody (4D4)

Images

 
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images for immunohistochemical staining of SPINK1in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20mg/kg ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images showing H&E staining (x200 magnification) and immunostaining (x200 magnification) for AR, synaptophysin, and SPINK1 in tumor specimens ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - IHC staining for SPINK1 and NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1mm. Image collected and ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice and NEPC patients. Representative images of immunohistochemical staining for the same ...read more
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit ...read more
ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.
Spatial gene expression heterogeneity within the 1.2 cancer tissue sample. a Factor activity maps for selected factors corresponding to epithelial, stromal, cancerous, PIN, or inflamed regions. Remaining factors' ...read more
Ectopic expression of Foxc1 alters invasion but not proliferation. a Transwell invasion assay of PyVmT cells expressing exogenous Foxc1 or GFP. Experiments were performed three times, and results are displayed relative ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPINK1 Antibody (4D4) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Localization
Secreted
Specificity
SPINK1 - serine protease inhibitor, Kazal type 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPINK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
Reviewed Applications
Read 1 Review rated 5
using
H00006690-M01 in the following applications:

Publications
Read Publications using
H00006690-M01 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 32929152)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPINK1 Antibody (4D4)

  • pancreatic secretory trypsin inhibitor
  • PCTT
  • PCTTSpink3
  • PSTI
  • PSTISerine protease inhibitor Kazal-type 1
  • serine peptidase inhibitor, Kazal type 1
  • serine protease inhibitor, Kazal type 1
  • SPINK1
  • Spink3
  • TATI
  • TATITumor-associated trypsin inhibitor

Background

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPINK1 Antibody (H00006690-M01)(31)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 5 applications: ICC/IF, IF/IHC, IHC, IHC-Fr, IHC-P.


Filter By Application
ICC/IF
(1)
IF/IHC
(4)
IHC
(1)
IHC-Fr
(1)
IHC-P
(4)
All Applications
Filter By Species
Human
(8)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 31. Show All 31 Publications.
Publications using H00006690-M01 Applications Species
Mehner C, Miller E, Hockla A et al. Targeting an autocrine IL-6-SPINK1 signaling axis to suppress metastatic spread in ovarian clear cell carcinoma Oncogene 2020-09-14 [PMID: 32929152] (IF/IHC, Mouse) IF/IHC Mouse
Palanisamy N, Arachchige PD, Carskadon S, Li J Clonal evaluation of prostate cancer molecular heterogeneity in biopsy samples by dual immunohistochemistry and dual RNA in situ hybridization Mod Pathol 2020-04-03 [PMID: 32238875]
Tiwari R, Manzar N, Bhatia V et al. Androgen deprivation upregulates SPINK1 expression and potentiates cellular plasticity in prostate cancer Nat Commun 2020-01-20 [PMID: 31959826] (IF/IHC, Human) IF/IHC Human
Lu Z, Williamson SR, Carskadon S et al. Clonal evaluation of early onset prostate cancer by expression profiling of ERG, SPINK1, ETV1, and ETV4 on whole-mount radical prostatectomy tissue Prostate 2020-01-01 [PMID: 31584209]
Vinceneux A, Bruyere F, Haillot O et al. Ductal adenocarcinoma of the prostate: Clinical and biological profiles. Prostate 2017-07-12 [PMID: 28699202]
Khani F, Mosquera JM, Park K et al. 325 DIFFERENCES IN TMPRSS2-ERG GENE FUSION AND SPINK1 OVEREXPRESSION IN PROSTATE CANCER IN AFRICAN-AMERICAN AND CAUCASIAN MEN. The Journal of Urology 2012-01-01
Faisal FA, Kaur HB, Tosoian JJ et al. SPINK1 expression is enriched in African American prostate cancer but is not associated with altered immune infiltration or oncologic outcomes post-prostatectomy. Prostate Cancer Prostatic Dis. 2019-03-08 [PMID: 30850708]
Bhatia V, Yadav A, Tiwari R et al. Polycomb Group protein EZH2-mediated transcriptional repression of microRNA-338/-421 drives SPINK1-positive prostate cancer bioRxiv 2018-07-24 (IHC-P, Human) IHC-P Human
Xiuyi P, Junya T, Xiaoxue Y et al. The roles of mutated SPINK1 gene in prostate cancer cells. Mutagenesis. 2022-09-16 [PMID: 36112498]
Shun S, Takahiro K, Hajime O et al. Transition zone prostate cancer is associated with better clinical outcomes than peripheral zone cancer. BJUI Compass. 2020-10-06 [PMID: 35475132]
Show All 31 Publications.

Review for SPINK1 Antibody (H00006690-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00006690-M01:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin SPINK1 H00006690-M01
Enlarge
5
reviewed by:
Verified Customer
IHC-P Mouse 02/10/2022
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedPancreas tissue
SpeciesMouse
Lot4D4

Comments

CommentsAntibody concentration 1 ug/ml

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPINK1 Antibody (H00006690-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK1 Products

Research Areas for SPINK1 Antibody (H00006690-M01)

Find related products by research area.

Blogs on SPINK1

There are no specific blogs for SPINK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
02/10/2022
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol SPINK1
Entrez
OMIM
Uniprot