SPINK1 Antibody (4D4)


Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - detection against Immunogen (31.9 KDa).Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit ...read more
ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, IP

Order Details

SPINK1 Antibody (4D4) Summary

SPINK1 (AAH25790, 24 a.a. - 79 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
SPINK1 - serine protease inhibitor, Kazal type 1
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, IP and Sandwich ELISA.
Read Publications using
H00006690-M01 in the following applications:

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPINK1 Antibody (4D4)

  • pancreatic secretory trypsin inhibitor
  • PCTT
  • PCTTSpink3
  • PSTI
  • PSTISerine protease inhibitor Kazal-type 1
  • serine peptidase inhibitor, Kazal type 1
  • serine protease inhibitor, Kazal type 1
  • SPINK1
  • Spink3
  • TATI
  • TATITumor-associated trypsin inhibitor


The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IP, ICC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC

Publications for SPINK1 Antibody (H00006690-M01)(16)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, IHC-P.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 16. Show All 16 Publications.
Publications using H00006690-M01 Applications Species
Vinceneux A, Bruyere F, Haillot O et al. Ductal adenocarcinoma of the prostate: Clinical and biological profiles. Prostate 2017 Jul 12 [PMID: 28699202]
Shek FH, Luo R, Lam BYH et al. Serine peptidase inhibitor Kazal type 1 (SPINK1) as novel downstream effector of the cadherin-17/B-catenin axis in hepatocellular carcinoma. Cell Oncol (Dordr) 2017 Jun 19 [PMID: 28631187]
Sakata K, Araki K, Nakano H et al. Novel method to rescue a lethal phenotype through integration of target gene onto the X-chromosome. Sci Rep 2016 Nov 15 [PMID: 27845447]
Zhang J, Wang D, Hu N et al. The construction and proliferative effects of a lentiviral vector capable of stably overexpressing SPINK1 gene in human pancreatic cancer AsPC-1 cell line. Tumour Biol. 2015 Nov 19 [PMID: 26586397]
Mehner C, Oberg AL, Kalli KR et al. Serine protease inhibitor Kazal type 1 (SPINK1) drives proliferation and anoikis resistance in a subset of ovarian cancers. Oncotarget 2015 Nov 3 [PMID: 26437224] (IHC-P, Human) IHC-P Human
Tiwari R, Pandey SK, Goel S et al. SPINK1 promotes colorectal cancer progression by downregulating Metallothioneins expression. Oncogenesis 2015 [PMID: 26258891] (ICC/IF) ICC/IF
Brooks JD, Wei W, Hawley S et al. Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients. PLoS One 2015 [PMID: 26172920] (IHC) IHC
Ateeq B, Kunju LP, Carskadon SL et al. Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India. Prostate. 2015 Mar 23 [PMID: 25809148]
Palanisamy N, Tsodikov A, Yan W et al. Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial. Urol Oncol. 2014 Aug 27 [PMID: 25175425]
Smith SC, Palanisamy N, Zuhlke KA et al. HOXB13 G84E-related familial prostate cancers: a clinical, histologic, and molecular survey. Am J Surg Pathol. 2014 May [PMID: 24722062] (IHC, Human) IHC Human
Show All 16 Publications.

Reviews for SPINK1 Antibody (H00006690-M01) (0)

There are no reviews for SPINK1 Antibody (H00006690-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPINK1 Antibody (H00006690-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPINK1 Products

Bioinformatics Tool for SPINK1 Antibody (H00006690-M01)

Discover related pathways, diseases and genes to SPINK1 Antibody (H00006690-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK1 Antibody (H00006690-M01)

Discover more about diseases related to SPINK1 Antibody (H00006690-M01).

Pathways for SPINK1 Antibody (H00006690-M01)

View related products by pathway.

PTMs for SPINK1 Antibody (H00006690-M01)

Learn more about PTMs related to SPINK1 Antibody (H00006690-M01).

Research Areas for SPINK1 Antibody (H00006690-M01)

Find related products by research area.

Blogs on SPINK1

There are no specific blogs for SPINK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPINK1 Antibody (4D4) and receive a gift card or discount.


Gene Symbol SPINK1