SPINK1 Antibody (4D4) - Azide and BSA Free

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.

Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.

Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.

Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0012.jpg

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0013.jpg

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0014.jpg

SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0015.jpg

Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit polyclonal antibody.

ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 is negatively correlated with AR in PCa patients.a Heatmap depicting AR & SPINK1 expression in TCGA-PRAD cohort (n = 180). Shades of yellow & blue represents expression values in log2 (RPM+1). b Representative micrographs depicting PCa tissue microarray (TMA) cores (n = 237), immunostained for SPINK1 & AR expression by immunohistochemistry (IHC). Top panel shows representative IHC for SPINK1 in SPINK1-negative (SPINK1−) & SPINK1-positive (SPINK1+) patients. Bottom panel represents IHC for AR expression in the tumor core from same patients. Scale bar represents 500 µm & 100 µm for the entire core & the inset images, respectively. c Bar plot showing percentage of IHC scoring for AR in the SPINK1+ & SPINK1− patients’ specimens. P-value for the Chi-Square test is indicated. d Contingency table for the AR & SPINK1 status. Patients showing high or medium expression of AR were grouped as AR-(Hi/Med), while patients with low or null AR expression were indicated as AR-(Low/Neg). P-value for Fisher’s exact test is indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Spatial gene expression heterogeneity within the 1.2 cancer tissue sample. a Factor activity maps for selected factors corresponding to epithelial, stromal, cancerous, PIN, or inflamed regions. Remaining factors’ activity maps in Supplementary Figure 2 & Supplementary Data 1. b Annotated brightfield image of H&E-stained tissue section. c Heatmap of the 20 most variable genes between cancer, PIN & normal gland regions, using spot sets from Supplementary Fig. 4b. Centered rlog: difference of rlog (variance-stabilized transform of ST expression data) & gene-wise mean rlog. Arrows highlight genes of interest validated by immunohistochemistry (IHC). d First two principal components of spot sets from c separate cancer, PIN & normal regions. e Array dot plots for SPINK1 & NPY. Circle size in array dot plots indicates normalized ST counts. f IHC staining for SPINK1 & NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1 mm Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29925878), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 4D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SPINK1 Antibody (4D4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
• Localization: Secreted
• Specificity: SPINK1 - serine protease inhibitor, Kazal type 1
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SPINK1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 32929152)

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPINK1 Antibody (4D4) - Azide and BSA Free

• pancreatic secretory trypsin inhibitor
• PCTT
• PCTTSpink3
• PSTI
• PSTISerine protease inhibitor Kazal-type 1
• serine peptidase inhibitor, Kazal type 1
• serine protease inhibitor, Kazal type 1
• SPINK1
• Spink3
• TATI
• TATITumor-associated trypsin inhibitor

Background

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPINK1 Antibody (H00006690-M01)(32)

Publications using H00006690-M01

• Man KF, Zhou L, Yu H et al. SPINK1-induced tumor plasticity provides a therapeutic window for chemotherapy in hepatocellular carcinoma Nature communications 2023-11-29 [PMID: 38030644]
• Abdullah S, Xiaodong L, Shisheng W et al. Enhancement of gemcitabine efficacy by K73-03 via epigenetically regulation of miR-421/SPINK1 in gemcitabine resistant pancreatic cancer cells. Phytomedicine. 2021-08-18 [PMID: 34450377]
• Mehner C, Miller E, Hockla A et al. Targeting an autocrine IL-6-SPINK1 signaling axis to suppress metastatic spread in ovarian clear cell carcinoma Oncogene 2020-09-14 [PMID: 32929152] (IF/IHC, Mouse)
• Khani F, Mosquera JM, Park K et al. 325 DIFFERENCES IN TMPRSS2-ERG GENE FUSION AND SPINK1 OVEREXPRESSION IN PROSTATE CANCER IN AFRICAN-AMERICAN AND CAUCASIAN MEN. The Journal of Urology 2012-01-01
• Bhatia V, Yadav A, Tiwari R et al. Polycomb Group protein EZH2-mediated transcriptional repression of microRNA-338/-421 drives SPINK1-positive prostate cancer bioRxiv 2018-07-24 (IHC-P, Human)
• Francesca Khani, Juan Miguel Mosquera, Kyung Park et al. 325 DIFFERENCES IN TMPRSS2-ERG GENE FUSION AND SPINK1 OVEREXPRESSION IN PROSTATE CANCER IN AFRICAN-AMERICAN AND CAUCASIAN MEN J Urol. 2012-04-01 (IHC-P, Human)
• Manzar N, Khan U, Goel A et al. An integrative proteomics approach identifies tyrosine kinase KIT as a novel therapeutic target for SPINK1-positive prostate cancer bioRxiv 2023-07-26 (IHC, Human)
• Xiuyi P, Junya T, Xiaoxue Y et al. The roles of mutated SPINK1 gene in prostate cancer cells. Mutagenesis. 2022-09-16 [PMID: 36112498]
• Shun S, Takahiro K, Hajime O et al. Transition zone prostate cancer is associated with better clinical outcomes than peripheral zone cancer. BJUI Compass. 2020-10-06 [PMID: 35475132]
• Palanisamy N, Arachchige PD, Carskadon S, Li J Clonal evaluation of prostate cancer molecular heterogeneity in biopsy samples by dual immunohistochemistry and dual RNA in situ hybridization Mod Pathol 2020-04-03 [PMID: 32238875]
• Tiwari R, Manzar N, Bhatia V et al. Androgen deprivation upregulates SPINK1 expression and potentiates cellular plasticity in prostate cancer Nat Commun 2020-01-20 [PMID: 31959826] (IF/IHC, Human)
• Lu Z, Williamson SR, Carskadon S et al. Clonal evaluation of early onset prostate cancer by expression profiling of ERG, SPINK1, ETV1, and ETV4 on whole-mount radical prostatectomy tissue Prostate 2020-01-01 [PMID: 31584209]
• Faisal FA, Kaur HB, Tosoian JJ et al. SPINK1 expression is enriched in African American prostate cancer but is not associated with altered immune infiltration or oncologic outcomes post-prostatectomy. Prostate Cancer Prostatic Dis. 2019-03-08 [PMID: 30850708]
• Patil PA, McKenney JK, Reynolds JP et al. Clinical significance and EZH2, ERG and SPINK1 protein expression in pure and mixed ductal adenocarcinoma of the prostate. Histol Histopathol 2018-09-24 [PMID: 30246858]
• Koide H, Kimura T, Inaba H et al. Comparison of ERG and SPINK1 expression among incidental and metastatic prostate cancer in Japanese men. Prostate 2018-07-26 [PMID: 30051483]
• Berglund E, Maaskola J, Schultz N et al. Spatial maps of prostate cancer transcriptomes reveal an unexplored landscape of heterogeneity Nat Commun 2018-06-20 [PMID: 29925878] (IHC-Fr, Human)
• Vinceneux A, Bruyere F, Haillot O et al. Ductal adenocarcinoma of the prostate: Clinical and biological profiles. Prostate 2017-07-12 [PMID: 28699202]
• Shek FH, Luo R, Lam BYH et al. Serine peptidase inhibitor Kazal type 1 (SPINK1) as novel downstream effector of the cadherin-17/B-catenin axis in hepatocellular carcinoma. Cell Oncol (Dordr) 2017-06-19 [PMID: 28631187]
• Sakata K, Araki K, Nakano H et al. Novel method to rescue a lethal phenotype through integration of target gene onto the X-chromosome. Sci Rep 2016-11-15 [PMID: 27845447]
• Zhang J, Wang D, Hu N et al. The construction and proliferative effects of a lentiviral vector capable of stably overexpressing SPINK1 gene in human pancreatic cancer AsPC-1 cell line. Tumour Biol. 2015-11-19 [PMID: 26586397]
• Mehner C, Oberg AL, Kalli KR et al. Serine protease inhibitor Kazal type 1 (SPINK1) drives proliferation and anoikis resistance in a subset of ovarian cancers. Oncotarget 2015-11-03 [PMID: 26437224] (IHC-P, Human)
• Tiwari R, Pandey SK, Goel S et al. SPINK1 promotes colorectal cancer progression by downregulating Metallothioneins expression. Oncogenesis 2015-01-01 [PMID: 26258891] (ICC/IF)
• Brooks JD, Wei W, Hawley S et al. Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients. PLoS One 2015-01-01 [PMID: 26172920] (IF/IHC)
• Ateeq B, Kunju LP, Carskadon SL et al. Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India. Prostate. 2015-03-23 [PMID: 25809148]
• Palanisamy N, Tsodikov A, Yan W et al. Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial. Urol Oncol. 2014-08-27 [PMID: 25175425]
• Smith SC, Palanisamy N, Zuhlke KA et al. HOXB13 G84E-related familial prostate cancers: a clinical, histologic, and molecular survey. Am J Surg Pathol. 2014-05-01 [PMID: 24722062] (IF/IHC, Human)
• Flavin R, Pettersson A, Hendrickson WK et al. SPINK1 protein expression and prostate cancer progression. Clin Cancer Res 2014-09-15 [PMID: 24687926]
• Marshall A, Lukk M, Kutter C et al. Global Gene Expression Profiling Reveals SPINK1 as a Potential Hepatocellular Carcinoma Marker PLoS One 2013-01-01 [PMID: 23527199] (IHC-P, Human)
• Bhalla R, Kunju LP, Tomlins SA et al. Novel dual-color immunohistochemical methods for detecting ERG-PTEN and ERG-SPINK1 status in prostate carcinoma. Mod Pathol. 2013-01-25 [PMID: 23348902]
• Rink M, Park K, Volkmer BG et al. Loss of SPINK1 expression is associated with unfavorable outcomes in urothelial carcinoma of the bladder after radical cystectomy. Urol Oncol. 2012-09-01 [PMID: 22944196]
• Han B, Mehra R, Suleman K et al. Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma. Mod Pathol 22(9):1176-85. 2009-09-01 [PMID: 19465903]
• Tomlins SA, Rhodes DR, Yu J et al. The role of SPINK1 in ETS rearrangement-negative prostate cancers. Cancer Cell;13(6):519-28. 2008-06-01 [PMID: 18538735]

Review for SPINK1 Antibody (H00006690-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-P Mouse 02/10/2022

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Pancreas tissue
• Species: Mouse
• Lot: 4D4

Comments

• Comments: Antibody concentration 1 ug/ml

Bioinformatics

• Gene Symbol: SPINK1
• Entrez:
  • 6690(Human)
• OMIM:
  • 167790(Human)
• Uniprot:
  • AAH25790(Human)