SPINK1 Antibody (4D4)


Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images for immunohistochemical staining of SPINK1in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20mg/kg ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images showing H&E staining (x200 magnification) and immunostaining (x200 magnification) for AR, synaptophysin, and SPINK1 in tumor specimens ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - IHC staining for SPINK1 and NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1mm. Image collected and ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice and NEPC patients. Representative images of immunohistochemical staining for the same ...read more
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit ...read more
ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Order Details

SPINK1 Antibody (4D4) Summary

SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
SPINK1 - serine protease inhibitor, Kazal type 1
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
Reviewed Applications
Read 1 Review rated 5
H00006690-M01 in the following applications:

Read Publications using
H00006690-M01 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 32929152)

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS, pH 7.4
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPINK1 Antibody (4D4)

  • pancreatic secretory trypsin inhibitor
  • PCTT
  • PCTTSpink3
  • PSTI
  • PSTISerine protease inhibitor Kazal-type 1
  • serine peptidase inhibitor, Kazal type 1
  • serine protease inhibitor, Kazal type 1
  • SPINK1
  • Spink3
  • TATI
  • TATITumor-associated trypsin inhibitor


The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: B/N, Flow, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for SPINK1 Antibody (H00006690-M01)(27)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-Fr, IHC-P.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 27. Show All 27 Publications.
Publications using H00006690-M01 Applications Species
Mehner C, Miller E, Hockla A et al. Targeting an autocrine IL-6-SPINK1 signaling axis to suppress metastatic spread in ovarian clear cell carcinoma Oncogene Sep 14 2020 [PMID: 32929152] (IHC, Mouse) IHC Mouse
Palanisamy N, Arachchige PD, Carskadon S, Li J Clonal evaluation of prostate cancer molecular heterogeneity in biopsy samples by dual immunohistochemistry and dual RNA in situ hybridization Mod Pathol Apr 3 2020 [PMID: 32238875]
Tiwari R, Manzar N, Bhatia V et al. Androgen deprivation upregulates SPINK1 expression and potentiates cellular plasticity in prostate cancer Nat Commun Jan 20 2020 [PMID: 31959826] (IHC, Human) IHC Human
Lu Z, Williamson SR, Carskadon S et al. Clonal evaluation of early onset prostate cancer by expression profiling of ERG, SPINK1, ETV1, and ETV4 on whole-mount radical prostatectomy tissue Prostate Jan 1 2020 [PMID: 31584209]
Vinceneux A, Bruyere F, Haillot O et al. Ductal adenocarcinoma of the prostate: Clinical and biological profiles. Prostate 2017 Jul 12 [PMID: 28699202]
Faisal FA, Kaur HB, Tosoian JJ et al. SPINK1 expression is enriched in African American prostate cancer but is not associated with altered immune infiltration or oncologic outcomes post-prostatectomy. Prostate Cancer Prostatic Dis. 2019 Mar 08 [PMID: 30850708]
Bhatia V, Yadav A, Tiwari R et al. Polycomb Group protein EZH2-mediated transcriptional repression of microRNA-338/-421 drives SPINK1-positive prostate cancer bioRxiv Jul 24 2018 (IHC-P, Human) IHC-P Human
Patil PA, McKenney JK, Reynolds JP et al. Clinical significance and EZH2, ERG and SPINK1 protein expression in pure and mixed ductal adenocarcinoma of the prostate. Histol Histopathol Sep 24 2018 [PMID: 30246858]
Koide H, Kimura T, Inaba H et al. Comparison of ERG and SPINK1 expression among incidental and metastatic prostate cancer in Japanese men. Prostate Jul 26 2018 [PMID: 30051483]
Show All 27 Publications.

Review for SPINK1 Antibody (H00006690-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00006690-M01:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin SPINK1 H00006690-M01
reviewed by:
Sarah Miller
IHC-P Mouse 02/10/2022


Sample TestedPancreas tissue


CommentsAntibody concentration 1 ug/ml

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPINK1 Antibody (H00006690-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPINK1 Products

Bioinformatics Tool for SPINK1 Antibody (H00006690-M01)

Discover related pathways, diseases and genes to SPINK1 Antibody (H00006690-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK1 Antibody (H00006690-M01)

Discover more about diseases related to SPINK1 Antibody (H00006690-M01).

Pathways for SPINK1 Antibody (H00006690-M01)

View related products by pathway.

PTMs for SPINK1 Antibody (H00006690-M01)

Learn more about PTMs related to SPINK1 Antibody (H00006690-M01).

Research Areas for SPINK1 Antibody (H00006690-M01)

Find related products by research area.

Blogs on SPINK1

There are no specific blogs for SPINK1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Sarah Miller
Application: IHC-P
Species: Mouse


Gene Symbol SPINK1