SPINK1 Antibody (4D4)

Images

 
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - detection against Immunogen (31.9 KDa).Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit ...read more
ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P, IP
Clone
4D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPINK1 Antibody (4D4) Summary

Immunogen
SPINK1 (AAH25790, 24 a.a. - 79 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Localization
Secreted
Specificity
SPINK1 - serine protease inhibitor, Kazal type 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPINK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P, IP and Sandwich ELISA.
Publications
Read Publications using
H00006690-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPINK1 Antibody (4D4)

  • pancreatic secretory trypsin inhibitor
  • PCTT
  • PCTTSpink3
  • PSTI
  • PSTISerine protease inhibitor Kazal-type 1
  • serine peptidase inhibitor, Kazal type 1
  • serine protease inhibitor, Kazal type 1
  • SPINK1
  • Spink3
  • TATI
  • TATITumor-associated trypsin inhibitor

Background

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3848
Species: Hu
Applications: WB, IHC, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBL1-17349
Species: Hu
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
MAB3586
Species: Hu
Applications: WB, IP
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
NBP2-12553
Species: Hu
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
355-BM/CF
Species: Hu, Mu, Rt
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu

Publications for SPINK1 Antibody (H00006690-M01)(14)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, IHC-P.


Filter By Application
ICC/IF
(1)
IHC
(2)
IHC-P
(2)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using H00006690-M01 Applications Species
Sakata K, Araki K, Nakano H et al. Novel method to rescue a lethal phenotype through integration of target gene onto the X-chromosome. Sci Rep 2016 Nov 15 [PMID: 27845447]
Zhang J, Wang D, Hu N et al. The construction and proliferative effects of a lentiviral vector capable of stably overexpressing SPINK1 gene in human pancreatic cancer AsPC-1 cell line. Tumour Biol. 2015 Nov 19 [PMID: 26586397]
Mehner C, Oberg AL, Kalli KR et al. Serine protease inhibitor Kazal type 1 (SPINK1) drives proliferation and anoikis resistance in a subset of ovarian cancers. Oncotarget 2015 Nov 3 [PMID: 26437224] (IHC-P, Human) IHC-P Human
Tiwari R, Pandey SK, Goel S et al. SPINK1 promotes colorectal cancer progression by downregulating Metallothioneins expression. Oncogenesis 2015 [PMID: 26258891] (ICC/IF) ICC/IF
Brooks JD, Wei W, Hawley S et al. Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients. PLoS One 2015 [PMID: 26172920] (IHC) IHC
Ateeq B, Kunju LP, Carskadon SL et al. Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India. Prostate. 2015 Mar 23 [PMID: 25809148]
Palanisamy N, Tsodikov A, Yan W et al. Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial. Urol Oncol. 2014 Aug 27 [PMID: 25175425]
Smith SC, Palanisamy N, Zuhlke KA et al. HOXB13 G84E-related familial prostate cancers: a clinical, histologic, and molecular survey. Am J Surg Pathol. 2014 May [PMID: 24722062] (IHC, Human) IHC Human
Flavin R, Pettersson A, Hendrickson WK et al. SPINK1 protein expression and prostate cancer progression. Clin Cancer Res 2014 Sep 15 [PMID: 24687926]
Marshall A, Lukk M, Kutter C et al. Global Gene Expression Profiling Reveals SPINK1 as a Potential Hepatocellular Carcinoma Marker PLoS One 2013 [PMID: 23527199] (IHC-P, Human) IHC-P Human
Show All 14 Publications.

Reviews for SPINK1 Antibody (H00006690-M01) (0)

There are no reviews for SPINK1 Antibody (H00006690-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPINK1 Antibody (H00006690-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK1 Products

Bioinformatics Tool for SPINK1 Antibody (H00006690-M01)

Discover related pathways, diseases and genes to SPINK1 Antibody (H00006690-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK1 Antibody (H00006690-M01)

Discover more about diseases related to SPINK1 Antibody (H00006690-M01).
 

Pathways for SPINK1 Antibody (H00006690-M01)

View related products by pathway.

PTMs for SPINK1 Antibody (H00006690-M01)

Learn more about PTMs related to SPINK1 Antibody (H00006690-M01).
 

Research Areas for SPINK1 Antibody (H00006690-M01)

Find related products by research area.

Blogs on SPINK1

There are no specific blogs for SPINK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK1 Antibody (4D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK1
Entrez
OMIM
Uniprot