SPINK1 Antibody (4D4)


Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - detection against Immunogen (31.9 KDa).Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit ...read more
Sandwich ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, IP, S-ELISA
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

SPINK1 Antibody (4D4) Summary

SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.Sequence:DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
SPINK1 - serine protease inhibitor, Kazal type 1
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), Immunoprecipitation and reactive against Recombinant Protein for Sandwich ELISA.
Read Publications using
H00006690-M01 in the following applications:

Reactivity Notes

Other species not tested.


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPINK1 Antibody (4D4)

  • pancreatic secretory trypsin inhibitor
  • PCTT
  • PCTTSpink3
  • PSTI
  • PSTISerine protease inhibitor Kazal-type 1
  • serine peptidase inhibitor, Kazal type 1
  • serine protease inhibitor, Kazal type 1
  • Spink3
  • TATI
  • TATITumor-associated trypsin inhibitor


The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, PA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: ICFlow
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA

Publications for SPINK1 Antibody (H00006690-M01)(11)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, IHC-P.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00006690-M01 Applications Species
Zhang J, Wang D, Hu N et al. The construction and proliferative effects of a lentiviral vector capable of stably overexpressing SPINK1 gene in human pancreatic cancer AsPC-1 cell line. Tumour Biol. 2015 Nov 19 [PMID:26586397]
Tiwari R, Pandey SK, Goel S et al. SPINK1 promotes colorectal cancer progression by downregulating Metallothioneins expression. Oncogenesis 2015 [PMID:26258891] (ICC/IF) ICC/IF
Brooks JD, Wei W, Hawley S et al. Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients. PLoS One 2015 [PMID:26172920] (IHC) IHC
Ateeq B, Kunju LP, Carskadon SL et al. Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India. Prostate. 2015 Mar 23 [PMID:25809148]
Palanisamy N, Tsodikov A, Yan W et al. Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial. Urol Oncol. 2014 Aug 27 [PMID:25175425]
Smith SC, Palanisamy N, Zuhlke KA et al. HOXB13 G84E-related familial prostate cancers: a clinical, histologic, and molecular survey. Am J Surg Pathol. 2014 May [PMID:24722062] (IHC, Human) IHC Human
Marshall A, Lukk M, Kutter C et al. Global Gene Expression Profiling Reveals SPINK1 as a Potential Hepatocellular Carcinoma Marker PLoS One 2013 [PMID:23527199] (IHC-P, Human) IHC-P Human
Bhalla R, Kunju LP, Tomlins SA et al. Novel dual-color immunohistochemical methods for detecting ERG-PTEN and ERG-SPINK1 status in prostate carcinoma. Mod Pathol. 2013 Jan 25 [PMID:23348902]
Rink M, Park K, Volkmer BG et al. Loss of SPINK1 expression is associated with unfavorable outcomes in urothelial carcinoma of the bladder after radical cystectomy. Urol Oncol. 2012 Sep 01 [PMID:22944196]
Han B, Mehra R, Suleman K et al. Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma. Mod Pathol 22(9):1176-85. 2009 Sep. [PMID:19465903]
Show All 11 Publications.

Reviews for SPINK1 Antibody (H00006690-M01) (0)

There are no reviews for SPINK1 Antibody (H00006690-M01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPINK1 Antibody (H00006690-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPINK1 Antibody (4D4) Products

Related Products by Gene

Bioinformatics Tool for SPINK1 Antibody (H00006690-M01)

Discover related pathways, diseases and genes to SPINK1 Antibody (H00006690-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK1 Antibody (H00006690-M01)

Discover more about diseases related to SPINK1 Antibody (H00006690-M01).

Pathways for SPINK1 Antibody (H00006690-M01)

View related products by pathway.

PTMs for SPINK1 Antibody (H00006690-M01)

Learn more about PTMs related to SPINK1 Antibody (H00006690-M01).

Research Areas for SPINK1 Antibody (H00006690-M01)

Find related products by research area.

Blogs on SPINK1

There are no specific blogs for SPINK1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol SPINK1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00006690-M01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought