CYP27A1 Antibody

Images

 
Western Blot: CYP27A1 Antibody [NBP2-32433] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: CYP27A1 Antibody [NBP2-32433] - Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Immunohistochemistry-Paraffin: CYP27A1 Antibody [NBP2-32433] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP27A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP27A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CYP27A1 Protein (NBP2-32433PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP27A1 Antibody

  • 12-alpha-triol 27-hydroxylase
  • 7-alpha
  • cholestanetriol 26-monooxygenase
  • CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
  • CTX5-beta-cholestane-3-alpha
  • CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
  • Cytochrome P450 27
  • cytochrome P450, family 27, subfamily A, polypeptide 1
  • cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1
  • Cytochrome P-450C27/25
  • EC 1.14.13.15
  • sterol 26-hydroxylase, mitochondrial
  • Sterol 27-hydroxylase
  • Vitamin D(3) 25-hydroxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB9120
Species: Hu
Applications: ICC
NBP2-35213
Species: Hu
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CYP27A1 Antibody (NBP2-32433) (0)

There are no publications for CYP27A1 Antibody (NBP2-32433).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP27A1 Antibody (NBP2-32433) (0)

There are no reviews for CYP27A1 Antibody (NBP2-32433). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CYP27A1 Antibody (NBP2-32433) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP27A1 Products

Bioinformatics Tool for CYP27A1 Antibody (NBP2-32433)

Discover related pathways, diseases and genes to CYP27A1 Antibody (NBP2-32433). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP27A1 Antibody (NBP2-32433)

Discover more about diseases related to CYP27A1 Antibody (NBP2-32433).
 

Pathways for CYP27A1 Antibody (NBP2-32433)

View related products by pathway.

PTMs for CYP27A1 Antibody (NBP2-32433)

Learn more about PTMs related to CYP27A1 Antibody (NBP2-32433).
 

Research Areas for CYP27A1 Antibody (NBP2-32433)

Find related products by research area.

Blogs on CYP27A1

There are no specific blogs for CYP27A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP27A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP27A1