ALCAM/CD166 Antibody

Images

 
Immunohistochemistry: ALCAM/CD166 Antibody [NBP1-88129] - Staining of human liver shows distinct membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALCAM/CD166 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALCAM/CD166 Protein (NBP1-88129PEP)
Publications
Read Publications using
NBP1-88129 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19603023)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALCAM/CD166 Antibody

  • activated leucocyte cell adhesion molecule
  • activated leukocyte cell adhesion moleculeFLJ38514
  • ALCAM
  • CD166 antigen
  • CD166
  • MEMDMGC71733

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
CD6
627-CD
Species: Hu
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
796-IC
Species: Mu
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for ALCAM/CD166 Antibody (NBP1-88129)(3)

Reviews for ALCAM/CD166 Antibody (NBP1-88129) (0)

There are no reviews for ALCAM/CD166 Antibody (NBP1-88129). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALCAM/CD166 Antibody (NBP1-88129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALCAM/CD166 Products

Bioinformatics Tool for ALCAM/CD166 Antibody (NBP1-88129)

Discover related pathways, diseases and genes to ALCAM/CD166 Antibody (NBP1-88129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALCAM/CD166 Antibody (NBP1-88129)

Discover more about diseases related to ALCAM/CD166 Antibody (NBP1-88129).
 

Pathways for ALCAM/CD166 Antibody (NBP1-88129)

View related products by pathway.

PTMs for ALCAM/CD166 Antibody (NBP1-88129)

Learn more about PTMs related to ALCAM/CD166 Antibody (NBP1-88129).
 

Research Areas for ALCAM/CD166 Antibody (NBP1-88129)

Find related products by research area.

Blogs on ALCAM/CD166

There are no specific blogs for ALCAM/CD166, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALCAM/CD166 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALCAM
Entrez