Aconitase 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining in human heart muscle and liver tissues using NBP1-90264 antibody. Corresponding ACO2 RNA-seq data are presented ...read more
Immunohistochemistry: Aconitase 2 Antibody [NBP1-90264] - STED super-resolution microscopy of mitochondria in the rectal Muscularis externa demonstrates high structural preservation of the stored paraffin-embedded ...read more
Immunocytochemistry/ Immunofluorescence: Aconitase 2 Antibody [NBP1-90264] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Western Blot: Aconitase 2 Antibody [NBP1-90264] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Western Blot: Aconitase 2 Antibody [NBP1-90264] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human duodenum shows strong strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human kidney shows strong strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Aconitase 2 Antibody [NBP1-90264] - Staining of human liver shows very weak positivity in hepatocytes as expected.
STED super-resolution microscopy of mitochondria in the rectal Muscularis externa demonstrates high structural preservation of the stored paraffin-embedded tissue.STED recordings were performed on 2 um thick dewaxed ...read more
Cx43-overexpressing cells regulate the expression of HIF-1 alpha , vascular endothelial growth factor (VEGF), and the proliferation of endothelial cells. (a) The expression of Cx43 and HIF-1 alpha was measured in ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Aconitase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Aconitase 2 Protein (NBP1-90264PEP)
Publications
Read Publications using
NBP1-90264 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aconitase 2 Antibody

  • aconitase 2, mitochondrial
  • Aconitase
  • aconitate hydratase, mitochondrial
  • ACONM
  • Citrate hydro-lyase
  • EC 4.2.1
  • EC 4.2.1.3
  • MGC20605
  • MGC33908

Background

Aconitase 2 is encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aconitase 2 Antibody (NBP1-90264)(3)

Reviews for Aconitase 2 Antibody (NBP1-90264) (0)

There are no reviews for Aconitase 2 Antibody (NBP1-90264). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aconitase 2 Antibody (NBP1-90264) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aconitase 2 Products

Research Areas for Aconitase 2 Antibody (NBP1-90264)

Find related products by research area.

Blogs on Aconitase 2

There are no specific blogs for Aconitase 2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aconitase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACO2
Entrez
Uniprot