alpha-N-acetylgalactosaminidase/NAGA Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit alpha-N-acetylgalactosaminidase/NAGA Antibody - BSA Free (NBP1-84318) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: WLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFST |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NAGA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200-1:500
- Western Blot 0.04 - 0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for alpha-N-acetylgalactosaminidase/NAGA Antibody - BSA Free
Background
NAGA, also known as alpha-N-acetylgalactosaminidase and alpha-galactosidase B, is a member of the glycosyl hydrolase 27 family. NAGA plays an important role in the breakdown of glycolipids by removing the terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. Additionally, NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase. Defects in the NAGA gene have been identified as the cause of Schindler type I and type II disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318) (0)
There are no publications for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318) (0)
There are no reviews for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha-N-acetylgalactosaminidase/NAGA Products
Research Areas for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318)
Find related products by research area.
|
Blogs on alpha-N-acetylgalactosaminidase/NAGA