alpha-N-acetylgalactosaminidase/NAGA Antibody

Images

 
Western Blot: alpha-N-acetylgalactosaminidase/NAGA Antibody [NBP1-84318] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: alpha-N-acetylgalactosaminidase/NAGA Antibody [NBP1-84318] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alpha-N-acetylgalactosaminidase/NAGA Antibody [NBP1-84318] - Analysis in human placenta and skeletal muscle tissues. Corresponding ...read more
Immunohistochemistry-Paraffin: alpha-N-acetylgalactosaminidase/NAGA Antibody [NBP1-84318] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: alpha-N-acetylgalactosaminidase/NAGA Antibody [NBP1-84318] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: alpha-N-acetylgalactosaminidase/NAGA Antibody [NBP1-84318] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

alpha-N-acetylgalactosaminidase/NAGA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAGA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alpha-N-acetylgalactosaminidase/NAGA Recombinant Protein Antigen (NBP1-84318PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-N-acetylgalactosaminidase/NAGA Antibody

  • alpha-N- (alpha-galactosidase B)
  • alphaNacetylgalactosaminidase
  • alpha-N-acetylgalactosaminidase
  • EC 3.2.1
  • EC 3.2.1.49
  • GALB
  • N-acetylgalactosaminidase, alpha-
  • NAGA

Background

NAGA, also known as alpha-N-acetylgalactosaminidase and alpha-galactosidase B, is a member of the glycosyl hydrolase 27 family. NAGA plays an important role in the breakdown of glycolipids by removing the terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. Additionally, NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase. Defects in the NAGA gene have been identified as the cause of Schindler type I and type II disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318) (0)

There are no publications for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318) (0)

There are no reviews for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-N-acetylgalactosaminidase/NAGA Products

Research Areas for alpha-N-acetylgalactosaminidase/NAGA Antibody (NBP1-84318)

Find related products by research area.

Blogs on alpha-N-acetylgalactosaminidase/NAGA

There are no specific blogs for alpha-N-acetylgalactosaminidase/NAGA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-N-acetylgalactosaminidase/NAGA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAGA