ACSL5 Antibody


Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.
Simple Western: ACSL5 Antibody [NBP1-59645] - Simple Western analysis of mouse liver lysate. Simple Western image submitted by a verified customer review.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, ZeSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P

Order Details

ACSL5 Antibody Summary

Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Bovine (92%), Zebrafish (93%), Canine (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/mL
  • Simple Western
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Paraffin 4 - 8 ug/mL
Application Notes
This is a rabbit polyclonal antibody against ACSL5 and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
NBP1-59645 in the following applications:

Read Publications using
NBP1-59645 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSL5 Antibody

  • ACS2
  • ACS5FACL5 for fatty acid coenzyme A ligase 5
  • acyl-CoA synthetase long-chain family member 5
  • EC 6.2.1
  • EC
  • FACL5fatty acid coenzyme A ligase 5
  • fatty-acid-Coenzyme A ligase, long-chain 5
  • LACS 5
  • Long-chain acyl-CoA synthetase 5
  • long-chain fatty acid coenzyme A ligase 5
  • long-chain-fatty-acid--CoA ligase 5


ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr

Publications for ACSL5 Antibody (NBP1-59645)(2)

Review for ACSL5 Antibody (NBP1-59645) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-59645:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot ACSL5 NBP1-59645
reviewed by:
WB Rat 09/04/2013


ApplicationWestern Blot

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL5 Antibody (NBP1-59645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ACSL5 Products

Bioinformatics Tool for ACSL5 Antibody (NBP1-59645)

Discover related pathways, diseases and genes to ACSL5 Antibody (NBP1-59645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL5 Antibody (NBP1-59645)

Discover more about diseases related to ACSL5 Antibody (NBP1-59645).

Pathways for ACSL5 Antibody (NBP1-59645)

View related products by pathway.

PTMs for ACSL5 Antibody (NBP1-59645)

Learn more about PTMs related to ACSL5 Antibody (NBP1-59645).

Research Areas for ACSL5 Antibody (NBP1-59645)

Find related products by research area.

Blogs on ACSL5

There are no specific blogs for ACSL5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Rat


Gene Symbol ACSL5