ACSL5 Antibody

Images

 
Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - Human skeletal muscle tissue at an antibody concentration of 4-8ug/ml.
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACSL5 and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
NBP1-59645 in the following applications:

Publications
Read Publications using
NBP1-59645 in the following applications:

  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSL5 Antibody

  • ACS2
  • ACS5FACL5 for fatty acid coenzyme A ligase 5
  • acyl-CoA synthetase long-chain family member 5
  • EC 6.2.1
  • EC 6.2.1.3
  • FACL5fatty acid coenzyme A ligase 5
  • fatty-acid-Coenzyme A ligase, long-chain 5
  • LACS 5
  • Long-chain acyl-CoA synthetase 5
  • long-chain fatty acid coenzyme A ligase 5
  • long-chain-fatty-acid--CoA ligase 5

Background

ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90276
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92088
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-89269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2540
Species: Hu
Applications: WB, IHC, IP
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
MAB6898
Species: Hu, Mu
Applications: WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58768
Species: Hu
Applications: ICC/IF
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-Fr

Publications for ACSL5 Antibody (NBP1-59645)(2)

Review for ACSL5 Antibody (NBP1-59645) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-59645:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ACSL5 NBP1-59645
Enlarge
reviewed by:
Anonymous
WB Rat 09/04/2013
View

Summary

ApplicationWestern Blot
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL5 Antibody (NBP1-59645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACSL5 Products

Bioinformatics Tool for ACSL5 Antibody (NBP1-59645)

Discover related pathways, diseases and genes to ACSL5 Antibody (NBP1-59645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL5 Antibody (NBP1-59645)

Discover more about diseases related to ACSL5 Antibody (NBP1-59645).
 

Pathways for ACSL5 Antibody (NBP1-59645)

View related products by pathway.

PTMs for ACSL5 Antibody (NBP1-59645)

Learn more about PTMs related to ACSL5 Antibody (NBP1-59645).
 

Research Areas for ACSL5 Antibody (NBP1-59645)

Find related products by research area.

Blogs on ACSL5

There are no specific blogs for ACSL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/04/2013
Application: WB
Species: Rat

Bioinformatics

Gene Symbol ACSL5
Uniprot