Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, Simple Western, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ACSL5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This is a rabbit polyclonal antibody against ACSL5 and was validated on Western blot. |
|
Theoretical MW | 76 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Celeste Wu |
Simple Western | Mouse | 07/01/2020 |
Summary
Comments
|
||||||||||
![]() Enlarge |
reviewed by:
Eric Klett |
WB | Rat | 09/04/2013 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for ACSL5 Antibody (NBP1-59645)Discover more about diseases related to ACSL5 Antibody (NBP1-59645).
| Pathways for ACSL5 Antibody (NBP1-59645)View related products by pathway.
|
PTMs for ACSL5 Antibody (NBP1-59645)Learn more about PTMs related to ACSL5 Antibody (NBP1-59645).
| Research Areas for ACSL5 Antibody (NBP1-59645)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Celeste Wu 07/01/2020 |
||
Application: | Simple Western | |
Species: | Mouse |
Eric Klett 09/04/2013 |
||
Application: | WB | |
Species: | Rat |