ACSL5 Antibody

Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.

Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - Human skeletal muscle tissue at an antibody concentration of 4-8ug/ml.

Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ACSL5 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ACSL5 and was validated on Western blot.
• Theoretical MW: 76 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSL5 Antibody

• ACS2
• ACS5FACL5 for fatty acid coenzyme A ligase 5
• acyl-CoA synthetase long-chain family member 5
• EC 6.2.1
• EC 6.2.1.3
• FACL5fatty acid coenzyme A ligase 5
• fatty-acid-Coenzyme A ligase, long-chain 5
• LACS 5
• Long-chain acyl-CoA synthetase 5
• long-chain fatty acid coenzyme A ligase 5
• long-chain-fatty-acid--CoA ligase 5

Background

ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ACSL5 Antibody (NBP1-59645)(2)

Publications using NBP1-59645

• Bauer PV, Duca FA, Waise TMZ et al. Lactobacillus gasseri in the Upper Small Intestine Impacts an ACSL3-Dependent Fatty Acid-Sensing Pathway Regulating Whole-Body Glucose Homeostasis. Cell Metab. Mar 6 2018 [PMID: 29514066] (WB)
• Klett EL, Chen S, Edin ML et al. Diminished acyl-CoA synthetase isoform 4 activity in INS 832/13 cells reduces cellular epoxyeicosatrienoic acid levels and results in impaired glucose-stimulated insulin secretion. J Biol Chem 2013 Jun 13 [PMID: 23766516] (WB, Rat)

Review for ACSL5 Antibody (NBP1-59645) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Anonymous WB Rat 09/04/2013

Summary

• Application: Western Blot
• Species: Rat

Bioinformatics

• Gene Symbol: ACSL5
• Uniprot:
  • Q9ULC5(Human)