Home » ACSL5 » ACSL5 Antibodies » ACSL5 Antibody

ACSL5 Antibody

 (2 Publications)
 (2 Reviews)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.
Simple Western: ACSL5 Antibody [NBP1-59645] - Simple Western analysis of mouse liver lysate. Simple Western image submitted by a verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ACSL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACSL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10 - 1:500
  • Immunohistochemistry-Paraffin 4 - 8 ug/mL
  • Simple Western
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACSL5 and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-59645 in the following applications:
Publications
Read Publications using
NBP1-59645 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACSL5 Antibody

  • ACS2
  • ACS5FACL5 for fatty acid coenzyme A ligase 5
  • acyl-CoA synthetase long-chain family member 5
  • EC 6.2.1
  • EC 6.2.1.3
  • FACL5fatty acid coenzyme A ligase 5
  • fatty-acid-Coenzyme A ligase, long-chain 5
  • LACS 5
  • Long-chain acyl-CoA synthetase 5
  • long-chain fatty acid coenzyme A ligase 5
  • long-chain-fatty-acid--CoA ligase 5

Background

ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Acetyl CoA
synthetase Antibody
NBP1-90276
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human stomach shows weak cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human tonsil shows no positivity in lymphocytes as expected.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ACSL1 Antibody
NBP1-89270
Immunocytochemistry/Immunofluorescence: ACSL1 Antibody [NBP1-89270] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ACSL1 Antibody [NBP1-89270] - Staining of human kidney, liver, soft tissues and tonsil using Anti-ACSL1 antibody NBP1-89270 (A) shows similar protein distribution across tissues to independent antibody NBP1-89271 (B).
Western Blot: ACSL1 Antibody [NBP1-89270] - Analysis using Anti-ACSL1 antibody NBP1-89270 (A) shows similar pattern to independent antibody NBP1-89271 (B).
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PHACS Antibody
NBP1-90260
Western Blot: PHACS Antibody [NBP1-90260] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: PHACS Antibody [NBP1-90260] - Staining of human tonsil shows strong cytoplasmic positivity.
Immunocytochemistry/Immunofluorescence: PHACS Antibody [NBP1-90260] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
LYPLA3 Antibody
NBP1-92089
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human colon strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human colon, kidney, lymph node and placenta using Anti-PLA2G15 antibody NBP1-92089 (A) shows similar protein distribution across tissues to independent antibody NBP1-92088 (B).
Immunohistochemistry-Paraffin: LYPLA3 Antibody [NBP1-92089] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: IHC, IHC-P, WB
FACL4 Antibody
NBP2-16401
Immunocytochemistry/Immunofluorescence: FACL4 Antibody [NBP2-16401] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FACL4 protein stained by FACL4 antibody [C3], C-term diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunocytochemistry/Immunofluorescence: FACL4 Antibody [NBP2-16401] - Confocal immunofluorescence analysis of methanol-fixed HeLa, using FACL4 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: FACL4 Antibody [NBP2-16401] - mouse kidney. FACL4 stained by FACL4 antibody [C3], C-term diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
ACSL3 Antibody
NBP2-15252
Simple Western: ACSL3 Antibody [NBP2-15252] - Mouse brain (hippocampus) tissue. Simple Western image submitted by a verified customer review.
Western Blot: ACSL3 Antibody [NBP2-15252] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ACSL3 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: ACSL3 Antibody [NBP2-15252] - IHC analysis of human breast cancer tissue section, using ACSL3 antibody at 1:500 dilution. Antigen Retrieval: Trilogy(TM) (EDTA based, pH 8.0) buffer for 15 min.
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
ACSL6 Antibody
NBP2-15253
Western Blot: ACSL6 Antibody [NBP2-15253] - Various tissue extracts (50 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ACSL6 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(1 Review)
Species: Mu, Rt
Applications: WB
Kallikrein 15
Antibody
NBP1-90265
Western Blot: Kallikrein 15 Antibody [NBP1-90265] - Analysis in control (vector only transfected HEK293T lysate) and KLK15 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.
Species: Hu
Applications: IHC, IHC-P, WB
Twist-1 Antibody
(10E4E6) - BSA Free
NBP2-37364
Flow Cytometry: Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on HeLa cells with Twist-1 Antibody (10E4E6)NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.
Flow (Intracellular): Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on HeLa cells with Twist-1 Antibody (10E4E6)NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550. Image from the DyLight 550 version of this antibody.
Flow Cytometry: Twist-1 Antibody (10E4E6) [NBP2-37364] - An intracellular stain was performed on SH-SY5Y cells with Twist-1 Antibody (10E4E6) NBP2-37364R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Acetyl-CoA
Carboxylase alpha/ACA ...
NBP3-15744
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Rat kidney using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Mouse testis using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody (5J4W7) [NBP3-15744] - Analysis of extracts of various cell lines, using Acetyl-CoA Carboxylase alpha/ACACA Rabbit mAb (NBP3-15744) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY licence.
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Analysis of Fatty Acid Synthase, using NB400-114. Samples: 50 ug of total mouse liver lysate.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(24 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Recombinant Human
LYST GST (N-Term) Pro ...
H00001130-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
FATP1/SLC27A1
Antibody (308420) [Un ...
MAB3304
FATP1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human FATP1 Monoclonal Antibody (Catalog # MAB3304) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
ACADS Antibody
NBP1-89290
Immunocytochemistry/Immunofluorescence: ACADS Antibody [NBP1-89290] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human tonsil shows granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
gamma Sarcoglycan
Antibody
NBP1-90299
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: gamma Sarcoglycan Antibody [NBP1-90299] - Staining in human heart muscle and prostate tissues using anti-SGCG antibody. Corresponding SGCG RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: gamma Sarcoglycan Antibody [NBP1-90299] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for ACSL5 Antibody (NBP1-59645)(2)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for ACSL5 Antibody (NBP1-59645) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Mouse, Rat.

Reviews using NBP1-59645:
Filter by Applications
Simple Western
(1)
WB
(1)
All Applications
Filter by Species
Mouse
(1)
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Simple Western ACSL5 NBP1-59645
Enlarge 		5
reviewed by:
Celeste Wu
 Simple Western Mouse 07/01/2020
View

Summary

ApplicationSimple Western
Sample Testedmouse liver lysate
SpeciesMouse
LotQC17535-190314

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.
Western Blot ACSL5 NBP1-59645
Enlarge 		4
reviewed by:
Eric Klett
 WB Rat 09/04/2013
View

Summary

ApplicationWestern Blot
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSL5 Antibody (NBP1-59645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACSL5 Products

Bioinformatics Tool for ACSL5 Antibody (NBP1-59645)

Discover related pathways, diseases and genes to ACSL5 Antibody (NBP1-59645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSL5 Antibody (NBP1-59645)

Discover more about diseases related to ACSL5 Antibody (NBP1-59645).
 

Pathways for ACSL5 Antibody (NBP1-59645)

View related products by pathway.

PTMs for ACSL5 Antibody (NBP1-59645)

Learn more about PTMs related to ACSL5 Antibody (NBP1-59645).
 

Research Areas for ACSL5 Antibody (NBP1-59645)

Find related products by research area.

Blogs on ACSL5

There are no specific blogs for ACSL5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Simple Western ACSL5 NBP1-59645
Enlarge
 Celeste Wu
07/01/2020
Application: Simple Western
Species: Mouse
read this review
Western Blot ACSL5 NBP1-59645
Enlarge
 Eric Klett
09/04/2013
Application: WB
Species: Rat
read this review

Bioinformatics

Gene Symbol ACSL5
Uniprot