Kallikrein 15 Antibody

Images

 
Western Blot: Kallikrein 15 Antibody [NBP1-90265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human stomach shows distinct positivity in Chief cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kallikrein 15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLK15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kallikrein 15 Protein (NBP1-90265PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kallikrein 15 Antibody

  • ACO protease
  • ACO
  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • HSRNASPH
  • Kallikrein 15
  • kallikrein-15
  • kallikrein-like serine protease
  • kallikrein-related peptidase 15
  • KLK15
  • Prostinogen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-92088
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2008
Species: Hu
Applications: WB, IHC, IP
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90265
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kallikrein 15 Antibody (NBP1-90265) (0)

There are no publications for Kallikrein 15 Antibody (NBP1-90265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 15 Antibody (NBP1-90265) (0)

There are no reviews for Kallikrein 15 Antibody (NBP1-90265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 15 Antibody (NBP1-90265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 15 Products

Bioinformatics Tool for Kallikrein 15 Antibody (NBP1-90265)

Discover related pathways, diseases and genes to Kallikrein 15 Antibody (NBP1-90265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 15 Antibody (NBP1-90265)

Discover more about diseases related to Kallikrein 15 Antibody (NBP1-90265).
 

Pathways for Kallikrein 15 Antibody (NBP1-90265)

View related products by pathway.

PTMs for Kallikrein 15 Antibody (NBP1-90265)

Learn more about PTMs related to Kallikrein 15 Antibody (NBP1-90265).
 

Research Areas for Kallikrein 15 Antibody (NBP1-90265)

Find related products by research area.

Blogs on Kallikrein 15

There are no specific blogs for Kallikrein 15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK15
Entrez