Kallikrein 15 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human kidney shows no positivity in cells in tubules or glomeruli.

Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in control (vector only transfected HEK293T lysate) and KLK15 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Kallikrein 15 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KLK15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Kallikrein 15 Protein (NBP1-90265PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Kallikrein 15 Antibody - BSA Free

• ACO protease
• ACO
• EC 3.4.21
• EC 3.4.21.-
• EC 3.4.21.4
• HSRNASPH
• Kallikrein 15
• kallikrein-15
• kallikrein-like serine protease
• kallikrein-related peptidase 15
• KLK15
• Prostinogen

Background

Kallikrein 15 are a subgroup of serine proteases and are implicated in carcinogenesis. KLK15 is up-regulated in more aggressive forms of prostate cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KLK15