Kallikrein 15 Antibody


Western Blot: Kallikrein 15 Antibody [NBP1-90265] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Kallikrein 15 Antibody [NBP1-90265] - Staining of human stomach shows distinct positivity in Chief cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Kallikrein 15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTS
Specificity of human Kallikrein 15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kallikrein 15 Protein (NBP1-90265PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Kallikrein 15 Antibody

  • ACO protease
  • ACO
  • EC 3.4.21
  • EC 3.4.21.-
  • EC
  • Kallikrein 15
  • kallikrein-15
  • kallikrein-like serine protease
  • kallikrein-related peptidase 15
  • KLK15
  • Prostinogen


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Kallikrein 15 Antibody (NBP1-90265) (0)

There are no publications for Kallikrein 15 Antibody (NBP1-90265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kallikrein 15 Antibody (NBP1-90265) (0)

There are no reviews for Kallikrein 15 Antibody (NBP1-90265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kallikrein 15 Antibody (NBP1-90265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Kallikrein 15 Products

Bioinformatics Tool for Kallikrein 15 Antibody (NBP1-90265)

Discover related pathways, diseases and genes to Kallikrein 15 Antibody (NBP1-90265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 15 Antibody (NBP1-90265)

Discover more about diseases related to Kallikrein 15 Antibody (NBP1-90265).

Pathways for Kallikrein 15 Antibody (NBP1-90265)

View related products by pathway.

PTMs for Kallikrein 15 Antibody (NBP1-90265)

Learn more about PTMs related to Kallikrein 15 Antibody (NBP1-90265).

Research Areas for Kallikrein 15 Antibody (NBP1-90265)

Find related products by research area.

Blogs on Kallikrein 15

There are no specific blogs for Kallikrein 15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Kallikrein 15 Antibody and receive a gift card or discount.


Gene Symbol KLK15