Acidic Calponin Antibody


Western Blot: Acidic Calponin Antibody [NBP1-68944] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Acidic Calponin Antibody Summary

Synthetic peptides corresponding to CNN3 (calponin 3, acidic) The peptide sequence was selected from the C terminal of CNN3. Peptide sequence GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CNN3 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Acidic Calponin Antibody

  • calponin 3, acidic
  • Calponin, acidic isoform
  • calponin-3
  • dJ639P13.2.2 (acidic calponin 3)


This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
Species: Hu
Applications: WB

Publications for Acidic Calponin Antibody (NBP1-68944) (0)

There are no publications for Acidic Calponin Antibody (NBP1-68944).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acidic Calponin Antibody (NBP1-68944) (0)

There are no reviews for Acidic Calponin Antibody (NBP1-68944). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Acidic Calponin Antibody (NBP1-68944) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Acidic Calponin Products

Bioinformatics Tool for Acidic Calponin Antibody (NBP1-68944)

Discover related pathways, diseases and genes to Acidic Calponin Antibody (NBP1-68944). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acidic Calponin Antibody (NBP1-68944)

Discover more about diseases related to Acidic Calponin Antibody (NBP1-68944).

Pathways for Acidic Calponin Antibody (NBP1-68944)

View related products by pathway.

PTMs for Acidic Calponin Antibody (NBP1-68944)

Learn more about PTMs related to Acidic Calponin Antibody (NBP1-68944).

Blogs on Acidic Calponin

There are no specific blogs for Acidic Calponin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Acidic Calponin Antibody and receive a gift card or discount.


Gene Symbol CNN3