ACE-2 Antibody (CL4013) Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED |
Epitope |
AEDLFYQSSL |
Specificity |
Specificity of human ACE-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
ACE2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1 ug/ml
- Immunohistochemistry 1:10000 - 1:20000
- Immunohistochemistry-Paraffin 1:10000 - 1:20000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for ACE-2 Antibody (CL4013)
Background
Angiotensin I Converting Enzyme 2 (ACE2), also known as ACEH (ACE homologue), is an integral membrane protein and a zinc metalloprotease of the ACE family (theoretical molecular weight 92 kDa). The predicted mouse ACE2 protein sequence consists of 798 amino acids, including an N-terminal signal peptide, a single catalytic domain, a C-terminal membrane anchor, and a short cytoplasmic tail. Mouse ACE2 is 40% homologous in amino acid identity to the N- and C-terminal domains of mouse somatic ACE. Enzymatically, ACE2 converts the inactive vasoconstrictor angiotensin I (AngI) to Ang1-9 and the active form AngII to Ang1-7, unlike ACE, which converts Ang I to Ang II.
Genetic data from Drosophila, mice and rats show that the ACE2 protein is an essential regulator of heart function in vivo. ACE2 mRNA is found at high levels in testis, kidney and heart with moderate levels in colon, small intestine, and ovary. The ACE2 protein contributes to organ function through the renin-angiotensin system, playing a central role in vascular, renal, and myocardial physiology.
Virology research has demonstrated that the severe acute respiratory syndrome coronavirus (SARS-CoV) spike protein binds to its functional receptor, ACE2 (1). Vimentin is a type III intermediate filament protein expressed in mesenchymal cells that helps comprise the cytoskeleton in all animal cells. Studies have demonstrated that vimentin allows cell binding that allows the uptake of SARS-CoV spike protein into a host (2). This direct interaction of SARS-CoV with vimentin has been identified as an entry mechanism for the virus into a host, mediated by the SARS-CoV receptor ACE2 (1,2). It has been shown that ACE2 is the SARS-CoV-2 receptor required for cell entry and plays a physiological role in the replication of SARS-CoV in an infected host (1). Studies using human ACE2 antibody demonstrated a blockade of SARS-CoV-2 and ACE2 interaction, indicating an important physiological component of viral transmission and potential anti-viral therapeutic strategies (3).
References
1. Li, W., Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A.,... Farzan, M. (2003). Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus. Nature, 426(6965), 450-454. doi:10.1038/nature02145
2. Yu YT, Chien SC, Chen IY, Lai CT, Tsay YG, Chang SC, Chang MF. (2016) Surface vimentin is critical for the cell entry of SARS-CoV. J Biomed Sci. doi: 10.1186/s12929-016-0234-7
3. Hoffmann, M., Kleine-Weber, H., Schroeder, S., Kruger, N., Herrler, T., Erichsen, S.,... Pohlmann, S. (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell. doi:10.1016/j.cell.2020.02.052
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
Publications for ACE-2 Antibody (NBP2-59036) (0)
There are no publications for ACE-2 Antibody (NBP2-59036).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ACE-2 Antibody (NBP2-59036) (0)
There are no reviews for ACE-2 Antibody (NBP2-59036).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ACE-2 Antibody (NBP2-59036) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional ACE-2 Products
Bioinformatics Tool for ACE-2 Antibody (NBP2-59036)
Discover related pathways, diseases and genes to ACE-2 Antibody (NBP2-59036). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ACE-2 Antibody (NBP2-59036)
Discover more about diseases related to ACE-2 Antibody (NBP2-59036).
| | Pathways for ACE-2 Antibody (NBP2-59036)
View related products by pathway.
|
PTMs for ACE-2 Antibody (NBP2-59036)
Learn more about PTMs related to ACE-2 Antibody (NBP2-59036).
| | Research Areas for ACE-2 Antibody (NBP2-59036)
Find related products by research area.
|
Blogs on ACE-2.
COVID-19-Related Neurological Problems: Uncovering the Mechanisms
By Jamshed Arslan, Pharm D, PhDThere is good news and bad news related to COVID-19, a disease caused by SARS-COV-2 infection. Good news first: the vast majority of otherwise healthy individuals remain asymptomatic... Read full blog post.
|
COVID-19 Pathology and Immune Response to SARS-CoV-2 Infection: Highlights from Studies at NIH, CDC, and Harvard
By Rosa Moreno, PhD. As the race for developing a vaccine to tackle the ongoing coronavirus disease (COVID-19) pandemic evolves, scientists at NIH, CDC and Harvard Medical School continue to make strides in understa... Read full blog post.
|
Tiny Antibodies (VHHs) from Llama Neutralize Respiratory Coronaviruses
By Jamshed Arslan, Pharm. D., PhD. VHH Single Domain Antibodies vs Conventional AntibodiesThe immune system protects living organisms against harmful substances. B cells ward off infections by producing antibodies t... Read full blog post.
|
Blocking SARS-CoV-2 Cell Entry: A potential Strategy Against COVID-19 Pandemic
By Jamshed Arslan, Pharm. D., PhD. Coronaviruses are a family of enveloped RNA viruses. Some family members circulate in human populations, but others like severe acute respiratory syndrome coronavirus (SARS-CoV) ar... Read full blog post.
|