ACBD5 Antibody - BSA Free

Western Blot: ACBD5 Antibody [NBP1-85145] - Analysis in human cell lines A-549 and PC-3. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: ACBD5 Antibody [NBP1-85145] - Staining of human cell line A-431 shows localization to nucleus & peroxisomes.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry: ACBD5 Antibody [NBP1-85145] - Analysis in human parathyroid gland and pancreas tissues using Anti-ACBD5 antibody. Corresponding ACBD5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human adrenal gland, colon, liver and testis using Anti-ACBD5 antibody NBP1-85145 (A) shows similar protein distribution across tissues to independent antibody NBP1-85146 (B).

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human adrenal gland.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human testis.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human liver.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human colon.

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human kidney, liver, pancreas and small intestine using Anti-ACBD5 antibody NBP1-85145 (A) shows similar protein distribution across tissues to independent antibody NBP1-85146 (B).

Immunohistochemistry-Paraffin: ACBD5 Antibody [NBP1-85145] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACBD5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACBD5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ACBD5 Protein (NBP1-85145PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ACBD5 Antibody - BSA Free

• acyl-CoA binding domain containing 5
• acyl-Coenzyme A binding domain containing 5
• DKFZp434A2417
• endozepine-related protein
• KIAA1996acyl-CoA-binding domain-containing protein 5
• membrane-associated diazepam binding inhibitor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACBD5
• Entrez:
  • 91452(Human)
• Uniprot:
  • Q5T8D3(Human)