ACF Antibody


Western Blot: ACF Antibody [NBP1-90271] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ACF Antibody [NBP1-90271] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ACF Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA
Specificity of human ACF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ACF Protein (NBP1-90271PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ACF Antibody

  • ACF65
  • apo-B RNA editing protein
  • apobec-1 complementation factor (ACF) (ASP)
  • APOBEC1 complementation factor
  • APOBEC-1 stimulating protein
  • APOBEC1-stimulating protein
  • MGC163391


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACF Antibody (NBP1-90271) (0)

There are no publications for ACF Antibody (NBP1-90271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACF Antibody (NBP1-90271) (0)

There are no reviews for ACF Antibody (NBP1-90271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACF Antibody (NBP1-90271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACF Products

Bioinformatics Tool for ACF Antibody (NBP1-90271)

Discover related pathways, diseases and genes to ACF Antibody (NBP1-90271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACF Antibody (NBP1-90271)

Discover more about diseases related to ACF Antibody (NBP1-90271).

Pathways for ACF Antibody (NBP1-90271)

View related products by pathway.

PTMs for ACF Antibody (NBP1-90271)

Learn more about PTMs related to ACF Antibody (NBP1-90271).

Blogs on ACF

There are no specific blogs for ACF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACF Antibody and receive a gift card or discount.


Gene Symbol A1CF