ACF Antibody

Images

 
Western Blot: ACF Antibody [NBP1-90271] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human colon shows moderate nuclear/cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Independent Antibodies: Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human colon, kidney, liver and tonsil using Anti-A1CF antibody NBP1-90271 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human tonsil shows no positivity as expected.
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ACF Antibody [NBP1-90271] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

ACF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA
Specificity
Specificity of human ACF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A1CF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACF Antibody

  • ACF65
  • ACFASPACF64
  • apo-B RNA editing protein
  • apobec-1 complementation factor (ACF) (ASP)
  • APOBEC1 complementation factor
  • APOBEC-1 stimulating protein
  • APOBEC1CF
  • APOBEC1-stimulating protein
  • MGC163391

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu, Rt, Po, Bv, Eq, Rb, Ze
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACF Antibody (NBP1-90271) (0)

There are no publications for ACF Antibody (NBP1-90271).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACF Antibody (NBP1-90271) (0)

There are no reviews for ACF Antibody (NBP1-90271). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACF Antibody (NBP1-90271) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACF Products

Bioinformatics Tool for ACF Antibody (NBP1-90271)

Discover related pathways, diseases and genes to ACF Antibody (NBP1-90271). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACF Antibody (NBP1-90271)

Discover more about diseases related to ACF Antibody (NBP1-90271).
 

Pathways for ACF Antibody (NBP1-90271)

View related products by pathway.

PTMs for ACF Antibody (NBP1-90271)

Learn more about PTMs related to ACF Antibody (NBP1-90271).

Blogs on ACF

There are no specific blogs for ACF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol A1CF