TDO2 Antibody

Images

 
Genetic Strategies: Knockout Validated: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted ...read more
Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. In the cerebellum, the immunoreactivity for TDO was observed in ...read more
Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by immunofluorescent staining. The hippocampal sections of wild-type and Tdo-/- mice were stained ...read more
Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in human liver.
Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. A TDO was not stained in the SVZ. The immunoreactivities for TDO in ...read more
Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. TDO was not stained in the olfactory bulb (OB). The ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

TDO2 Antibody Summary

Immunogen
TDO2 (NP_005642.1, 1 a.a. - 406 a.a.) full-length human protein. MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Specificity
TDO2 - tryptophan 2,3-dioxygenase,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TDO2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Publications
Read Publications using
H00006999-B01P in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27190010). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TDO2 Antibody

  • chky
  • TDO
  • TDO2
  • TDOTO
  • TO
  • TPH2EC 1.13.11.11
  • TRPO
  • TRPOtryptophanase
  • Tryptamin 2,3-dioxygenase
  • tryptophan 2,3-dioxygenase
  • Tryptophan Oxygenase
  • Tryptophan Pyrrolase
  • Tryptophanase

Background

Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-86922
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1892
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86335
Species: Hu
Applications: IHC, IHC-P
NBP1-56545
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45731
Species: All-NA
Applications: WB, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85892
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-02332
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006999-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TDO2 Antibody (H00006999-B01P)(4)

Reviews for TDO2 Antibody (H00006999-B01P) (0)

There are no reviews for TDO2 Antibody (H00006999-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TDO2 Antibody (H00006999-B01P). (Showing 1 - 1 of 1 FAQs).

  1. Why do you guys see two different molecular weight bands, one around 46 kDa in HEK cell lysates and the other around 50 kDa in liver lysates?
    • From the data I have available, the reason you see the molecular weight running slightly lower in the HEK lysate is because these cells were transfected with a partial length protein (a few aa short of the full length). The liver lysate will show you the correct sizing of the endogenous expression. The theoretical molecular weight of this protein is ~48kDa. However the observed weight can vary slightly due to your experimental conditions.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TDO2 Products

Bioinformatics Tool for TDO2 Antibody (H00006999-B01P)

Discover related pathways, diseases and genes to TDO2 Antibody (H00006999-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDO2 Antibody (H00006999-B01P)

Discover more about diseases related to TDO2 Antibody (H00006999-B01P).
 

Pathways for TDO2 Antibody (H00006999-B01P)

View related products by pathway.

PTMs for TDO2 Antibody (H00006999-B01P)

Learn more about PTMs related to TDO2 Antibody (H00006999-B01P).

Blogs on TDO2

There are no specific blogs for TDO2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDO2
Entrez
Uniprot