ABCG5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ABCG5 Antibody [NBP1-80712] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABCG5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABCG5 Antibody - BSA Free (NBP1-80712) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-ABCG5 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKDSPGVFSKLGVLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCG5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ABCG5 Protein (NBP1-80712PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABCG5 Antibody - BSA Free

• ATP-binding cassette sub-family G member 5
• ATP-binding cassette, sub-family G (WHITE), member 5
• ATP-binding cassette, subfamily G, member 5
• sterolin 1
• sterolin-1
• STSL

Background

The protein encoded by the ABCG5 gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABCproteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into sevendistinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily.The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliaryexcretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene istandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene maycontribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABCG5 Antibody (NBP1-80712)(5)

Publications using NBP1-80712

• Ma R, Lu D, Xie Q et al. l-Borneol and d-Borneol promote transdifferentiation of astrocytes into neurons in rats by regulating Wnt/Notch pathway to exert neuroprotective effect during recovery from cerebral ischaemia Phytomedicine 2022-12-01 [PMID: 36610167] (WB, Rat)
• Chen Y, Yang S, Liu L et al. A novel therapy for hepatic cholestasis treatment-the combination of rosiglitazone and fenofibrate European journal of pharmacology 2022-11-24 [PMID: 36436592] (WB, Mouse)
• Manna PR, Reddy AP, Pradeepkiran JA et al. Regulation of retinoid mediated StAR transcription and steroidogenesis in hippocampal neuronal cells: Implications for StAR in protecting Alzheimer's disease Biochimica et biophysica acta. Molecular basis of disease 2022-11-07 [PMID: 36356843] (ELISA)
• Ahn SB, Jun DW, Jang K et al. Duodenal Niemann-Pick C1-like 1 expression was negatively correlated with liver X receptor expression in nonalcoholic fatty liver disease Korean J. Intern. Med. 2019-07-01 [PMID: 29466845]
• Ahn Sang Bong, Jang Kiseok, Jun Dae Won et al. Expression of liver X receptor correlates with intrahepatic inflammation and fibrosis in patients with nonalcoholic fatty liver disease. Dig Dis Sci. 2014-08-08 [PMID: 25102981] (Human)

Bioinformatics

• Gene Symbol: ABCG5
• Entrez:
  • 64240(Mouse)
  • 64240(Mouse)
  • 64240(Mouse)
• Uniprot:
  • Q9H222(Human)