17 beta-HSD1/HSD17B1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: 17 beta-HSD1/HSD17B1 Antibody [NBP1-84901] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: 17 beta-HSD1/HSD17B1 Antibody [NBP1-84901] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in Syncytiotrophoblasts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

17 beta-HSD1/HSD17B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
17 beta-HSD1/HSD17B1 Protein (NBP1-84901PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 17 beta-HSD1/HSD17B1 Antibody

  • 17 betaHSD1
  • 17 beta-HSD1
  • 17-beta-HSD 1
  • 17-beta-hydroxysteroid dehydrogenase type 1
  • 20 alpha-hydroxysteroid dehydrogenase
  • 20-alpha-HSD
  • E17KSR
  • E2DH
  • EC 1.1.1.62
  • EDH17B1
  • EDH17B2
  • EDH17B2EDHB17
  • EDHB17
  • estradiol 17-beta-dehydrogenase 1
  • estradiol 17-beta-dehydrogenase-1
  • HSD17
  • HSD17B1
  • hydroxysteroid (17-beta) dehydrogenase 1 isoform
  • hydroxysteroid (17-beta) dehydrogenase 1
  • MGC138140
  • Placental 17-beta-hydroxysteroid dehydrogenase
  • SDR28C1
  • short chain dehydrogenase/reductase family 28CE, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901) (0)

There are no publications for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901) (0)

There are no reviews for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 17 beta-HSD1/HSD17B1 Products

Bioinformatics Tool for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901)

Discover related pathways, diseases and genes to 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901)

Discover more about diseases related to 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901).
 

Pathways for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901)

View related products by pathway.

PTMs for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901)

Learn more about PTMs related to 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901).
 

Research Areas for 17 beta-HSD1/HSD17B1 Antibody (NBP1-84901)

Find related products by research area.

Blogs on 17 beta-HSD1/HSD17B1

There are no specific blogs for 17 beta-HSD1/HSD17B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 17 beta-HSD1/HSD17B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B1
Entrez