SI Sucrase-Isomaltase Antibody

Images

 
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human stomach shows no positivity in glandular cells as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine and stomach tissues. Corresponding SI RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human colon shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SI Sucrase-Isomaltase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PAVDEISDSTSTPATTRVTTNPSDSGKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYV
Specificity
Specificity of human SI Sucrase-Isomaltase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-87581.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23345591)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SI Sucrase-Isomaltase Antibody

  • EC 3.2.1.20
  • MGC131621
  • MGC131622
  • oligosaccharide alpha-1,6-glucosidase
  • sucrase-isomaltase (alpha-glucosidase)
  • sucrase-isomaltase
  • sucrase-isomaltase, intestinal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-395
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67605
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-83790
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF1107
Species: Mu
Applications: WB, IHC
H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP1-89156
Species: Hu
Applications: IHC, IHC-P
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for SI Sucrase-Isomaltase Antibody (NBP1-87581)(1)

Reviews for SI Sucrase-Isomaltase Antibody (NBP1-87581) (0)

There are no reviews for SI Sucrase-Isomaltase Antibody (NBP1-87581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SI Sucrase-Isomaltase Antibody (NBP1-87581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SI Sucrase-Isomaltase Products

Bioinformatics Tool for SI Sucrase-Isomaltase Antibody (NBP1-87581)

Discover related pathways, diseases and genes to SI Sucrase-Isomaltase Antibody (NBP1-87581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SI Sucrase-Isomaltase Antibody (NBP1-87581)

Discover more about diseases related to SI Sucrase-Isomaltase Antibody (NBP1-87581).
 

Pathways for SI Sucrase-Isomaltase Antibody (NBP1-87581)

View related products by pathway.

PTMs for SI Sucrase-Isomaltase Antibody (NBP1-87581)

Learn more about PTMs related to SI Sucrase-Isomaltase Antibody (NBP1-87581).

Blogs on SI Sucrase-Isomaltase

There are no specific blogs for SI Sucrase-Isomaltase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SI Sucrase-Isomaltase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SI