ZNF444 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF444 Antibody [NBP2-56263] - Staining of human cell line HEK 293 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF444 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGE
Specificity
Specificity of human ZNF444 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF444
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 81%, Rat 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF444 Antibody

  • HZF3
  • MGC126498
  • zinc finger protein 268
  • zinc finger protein 3
  • Zinc finger protein HZF3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38747
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2409
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-80358
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-53228
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-52461
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-104
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67344
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56156
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-57508
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC

Publications for ZNF444 Antibody (NBP2-56263) (0)

There are no publications for ZNF444 Antibody (NBP2-56263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF444 Antibody (NBP2-56263) (0)

There are no reviews for ZNF444 Antibody (NBP2-56263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF444 Antibody (NBP2-56263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF444 Products

Bioinformatics Tool for ZNF444 Antibody (NBP2-56263)

Discover related pathways, diseases and genes to ZNF444 Antibody (NBP2-56263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF444 Antibody (NBP2-56263)

Discover more about diseases related to ZNF444 Antibody (NBP2-56263).
 

Pathways for ZNF444 Antibody (NBP2-56263)

View related products by pathway.

Blogs on ZNF444

There are no specific blogs for ZNF444, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF444 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF444