Epsin 1 Antibody - Azide and BSA Free

Western Blot: Epsin 1 Antibody [NBP3-03439] - Analysis of extracts of various cell lines, using Epsin 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Immunohistochemistry-Paraffin: Epsin 1 Antibody [NBP3-03439] - Immunohistochemistry of paraffin-embedded Mouse kidney using Epsin 1 Rabbit pAb (NBP3-03439) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Epsin 1 Antibody [NBP3-03439] - Immunohistochemistry of paraffin-embedded Rat kidney using Epsin 1 Rabbit pAb (NBP3-03439) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Epsin 1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Epsin 1 Antibody - Azide and BSA Free (NBP3-03439) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-180 of human Epsin 1 (NP_037465.2). LVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Epsin 1 Antibody - Azide and BSA Free

• EH domain-binding mitotic phosphoprotein
• EPS-15-interacting protein 1
• epsin 1
• epsin-1

Background

EPN1 is an endocytic accessory protein that interacts with EPS15 (MIM 600051), the alpha subunit of the clathrin adaptor AP2 (AP2A1; MIM 601026), and clathrin (see MIM 118960), as well as with other accessory proteins for the endocytosis of clathrin-coated vesicles.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EPN1