DNASE1 Antibody


Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

DNASE1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQLAQAISDHY
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNASE1 Protein (NBP1-84999PEP)
Read Publication using NBP1-84999.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%). Reactivity reported in scientific literature (PMID: 23169882)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNASE1 Antibody

  • deoxyribonuclease IFLJ38093
  • deoxyribonuclease-1
  • DKFZp686H0155
  • DNase I
  • DNase I, lysosomal
  • DNL1FLJ44902
  • Dornase alfa
  • DRNI
  • EC
  • human urine deoxyribonuclease I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNASE1 Antibody (NBP1-84999)(1)

Reviews for DNASE1 Antibody (NBP1-84999) (0)

There are no reviews for DNASE1 Antibody (NBP1-84999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNASE1 Antibody (NBP1-84999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DNASE1 Products

Bioinformatics Tool for DNASE1 Antibody (NBP1-84999)

Discover related pathways, diseases and genes to DNASE1 Antibody (NBP1-84999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNASE1 Antibody (NBP1-84999)

Discover more about diseases related to DNASE1 Antibody (NBP1-84999).

Pathways for DNASE1 Antibody (NBP1-84999)

View related products by pathway.

PTMs for DNASE1 Antibody (NBP1-84999)

Learn more about PTMs related to DNASE1 Antibody (NBP1-84999).

Research Areas for DNASE1 Antibody (NBP1-84999)

Find related products by research area.

Blogs on DNASE1

There are no specific blogs for DNASE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNASE1 Antibody and receive a gift card or discount.


Gene Symbol DNASE1