DNASE1 Antibody

Western Blot: DNASE1 Antibody [NBP1-84999] - Analysis in control (vector only transfected HEK293T lysate) and DNASE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Analysis in human duodenum and liver tissues using Anti-DNASE1 antibody. Corresponding DNASE1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DNASE1 Antibody [NBP1-84999] - Staining of human liver shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DNASE1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YVRPSQWSSIRLWTSPTFQWLIPDSADTTATPTHCAYDRIVVAGMLLRGAVVPDSALPFNFQAAYGLSDQLAQAISDHY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNASE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DNASE1 Protein (NBP1-84999PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%). Reactivity reported in scientific literature (PMID: 23169882)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNASE1 Antibody

• deoxyribonuclease IFLJ38093
• deoxyribonuclease-1
• DKFZp686H0155
• DNase I
• DNase I, lysosomal
• DNL1FLJ44902
• Dornase alfa
• DRNI
• EC 3.1.21.1
• human urine deoxyribonuclease I

Background

DNASE1, also known as Deoxyribonuclease 1, is an endonuclease found in the zymogen granules of the nuclear envelope. Responsible for DNA fragmentation and cell death during apoptosis, DNASE1 binds to G-actin and blocks actin polymerization. Mutations in DNASE1 cause systemic lupus erythematosus (SLE), an autoimmune disease causing inflammation and tissue damage. DNASE1 is also known to treat symptoms of cystic fibrosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNASE1 Antibody (NBP1-84999)(1)

Publication using NBP1-84999

• Sonawane S, Khanolkar V, Namavari A et al. Ocular Surface Extracellular DNA and Nuclease Activity Imbalance: A New Paradigm for Inflammation in Dry Eye Disease. Invest Ophthalmol Vis Sci 2012-12-17 [PMID: 23169882]

Bioinformatics

• Gene Symbol: DNASE1