We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ATF1 Antibody - BSA Free

Images

 
Genetic Strategies: Western Blot: ATF1 Antibody [NBP2-38747] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATF1 antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: ATF1 Antibody [NBP2-38747] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining in human thyroid gland and pancreas tissues using anti-ATF1 antibody. Corresponding ATF1 RNA-seq data are presented for ...read more
Immunohistochemistry: ATF1 Antibody [NBP2-38747] - Staining of human kidney shows moderate nuclear positivity in renal tubules and cells in glomeruli.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human thyroid gland shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

ATF1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATF1 Protein (NBP2-38747PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ATF1 Antibody - BSA Free

  • activating transcription factor 1FUS/ATF-1
  • ATF1
  • cAMP-dependent transcription factor ATF-1
  • EWS-ATF1
  • Protein TREB36
  • TREB36
  • TREB36cyclic AMP-dependent transcription factor ATF-1

Background

ATF2 (Activating Transcription Factor 2, CREBP, HB16, CREB2, TREB7) is a member of the ATF/CREB family of basic region leucine zipper DNA binding proteins that regulates transcription by binding to a consensus cAMP response element (CRE) in the promoter of various viral and cellular genes. Many of these genes are important in cell growth and differentiation, and in stress and immune responses. ATF2 is a nuclear protein that binds DNA as a dimer and can form dimers with members of the ATF/CREB and Jun/Fos families. It is a stronger activator as a heterodimer with cJun than as a homodimer. Several isoforms of ATF2 arise by differential splicing. The stable native full length ATF2 is transcriptionally inactive as a result of an inhibitory direct intramolecular interaction of its carboxy terminal DNA binding domain with the amino terminal transactivation domain. Following dimerization ATF2 becomes a short lived protein that undergoes ubiquitination and proteolysis, seemingly in a protein phosphatase-dependent mechanism. Stimulation of the transcriptional activity of ATF2 occurs following cellular stress induced by several genotoxic agents, inflammatory cytokines, and UV irradiation. This activation requires phosphorylation of two threonine residues in ATF2 by both JNK/SAP kinase and p38 MAP kinase. ATF2 is abundantly expressed in brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90364
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, Simple Western, WB
212-GD
Species: Hu
Applications: Bind, BA
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
1310-SE
Species: Hu
Applications: EnzAct
NBP1-92686
Species: Ca, Eq, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00001390-M02
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56530
Species: Hu
Applications: WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB

Publications for ATF1 Antibody (NBP2-38747) (0)

There are no publications for ATF1 Antibody (NBP2-38747).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATF1 Antibody (NBP2-38747) (0)

There are no reviews for ATF1 Antibody (NBP2-38747). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATF1 Antibody (NBP2-38747) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF1 Products

Research Areas for ATF1 Antibody (NBP2-38747)

Find related products by research area.

Blogs on ATF1

There are no specific blogs for ATF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF1
Uniprot