ATF1 Antibody - BSA Free

Western Blot: ATF1 Antibody [NBP2-38747] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATF1 antibody. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: ATF1 Antibody [NBP2-38747] - Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining in human thyroid gland and pancreas tissues using anti-ATF1 antibody. Corresponding ATF1 RNA-seq data are presented for the same tissues.

Immunohistochemistry: ATF1 Antibody [NBP2-38747] - Staining of human kidney shows moderate nuclear positivity in renal tubules and cells in glomeruli.

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ATF1 Antibody [NBP2-38747] - Staining of human thyroid gland shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATF1 Antibody - BSA Free (NBP2-38747) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ATF1 Protein (NBP2-38747PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATF1 Antibody - BSA Free

• activating transcription factor 1FUS/ATF-1
• ATF1
• cAMP-dependent transcription factor ATF-1
• EWS-ATF1
• Protein TREB36
• TREB36
• TREB36cyclic AMP-dependent transcription factor ATF-1

Background

ATF2 (Activating Transcription Factor 2, CREBP, HB16, CREB2, TREB7) is a member of the ATF/CREB family of basic region leucine zipper DNA binding proteins that regulates transcription by binding to a consensus cAMP response element (CRE) in the promoter of various viral and cellular genes. Many of these genes are important in cell growth and differentiation, and in stress and immune responses. ATF2 is a nuclear protein that binds DNA as a dimer and can form dimers with members of the ATF/CREB and Jun/Fos families. It is a stronger activator as a heterodimer with cJun than as a homodimer. Several isoforms of ATF2 arise by differential splicing. The stable native full length ATF2 is transcriptionally inactive as a result of an inhibitory direct intramolecular interaction of its carboxy terminal DNA binding domain with the amino terminal transactivation domain. Following dimerization ATF2 becomes a short lived protein that undergoes ubiquitination and proteolysis, seemingly in a protein phosphatase-dependent mechanism. Stimulation of the transcriptional activity of ATF2 occurs following cellular stress induced by several genotoxic agents, inflammatory cytokines, and UV irradiation. This activation requires phosphorylation of two threonine residues in ATF2 by both JNK/SAP kinase and p38 MAP kinase. ATF2 is abundantly expressed in brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATF1
• Uniprot:
  • P18846()