Exosome component 6 Antibody


Western Blot: Exosome component 6 Antibody [NBP1-57508] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
Immunohistochemistry-Paraffin: Exosome component 6 Antibody [NBP1-57508] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Immunohistochemistry-Paraffin: Exosome component 6 Antibody [NBP1-57508] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Product Details

Reactivity Hu, Rt, BvSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Exosome component 6 Antibody Summary

Synthetic peptides corresponding to EXOSC6 (exosome component 6) The peptide sequence was selected from the N terminal of Exosome component 6. Peptide sequence MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Bovine (93%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against Exosome component 6 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Exosome component 6 Antibody

  • EAP4
  • exosome component 6hMtr3
  • hMtr3p
  • homolog of yeast mRNA transport regulator 3
  • Mtr3 (mRNA transport regulator 3)-homolog
  • MTR3mRNA transport regulator 3 homolog
  • Mtr3p
  • p11exosome complex exonuclease MTR3


EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD, KO
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Exosome component 6 Antibody (NBP1-57508) (0)

There are no publications for Exosome component 6 Antibody (NBP1-57508).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Exosome component 6 Antibody (NBP1-57508) (0)

There are no reviews for Exosome component 6 Antibody (NBP1-57508). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Exosome component 6 Antibody (NBP1-57508) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Exosome component 6 Products

Bioinformatics Tool for Exosome component 6 Antibody (NBP1-57508)

Discover related pathways, diseases and genes to Exosome component 6 Antibody (NBP1-57508). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Exosome component 6 Antibody (NBP1-57508)

Discover more about diseases related to Exosome component 6 Antibody (NBP1-57508).

Blogs on Exosome component 6

There are no specific blogs for Exosome component 6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Exosome component 6 Antibody and receive a gift card or discount.


Gene Symbol EXOSC6