ZNF350 Antibody

Images

 
Western Blot: ZNF350 Antibody [NBP1-80608] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunocytochemistry/ Immunofluorescence: ZNF350 Antibody [NBP1-80608] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: ZNF350 Antibody [NBP1-80608] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF350 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ
Specificity
Specificity of human ZNF350 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF350
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF350 Protein (NBP1-80608PEP)
Publications
Read Publication using NBP1-80608.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF350 Antibody

  • Berg36
  • BRF1zinc finger protein 36, C3H1 type-like 1
  • Butyrate response factor 1
  • cMG1
  • ERF1ERF-1
  • Protein TIS11B
  • RNF162BEGF-response factor 1
  • TIS11Bearly response factor Berg36
  • zinc finger protein 36, C3H type-like 1
  • zinc finger protein, C3H type, 36-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
AF5510
Species: Hu
Applications: WB
MAB2476
Species: Hu
Applications: WB, IHC
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92139
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF5776
Species: Hu
Applications: WB, IHC
H00025793-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-43640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-20322
Species: Hu
Applications: WB, IP, ChIP, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF350 Antibody (NBP1-80608)(1)

Reviews for ZNF350 Antibody (NBP1-80608) (0)

There are no reviews for ZNF350 Antibody (NBP1-80608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF350 Antibody (NBP1-80608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF350 Antibody (NBP1-80608)

Discover related pathways, diseases and genes to ZNF350 Antibody (NBP1-80608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF350 Antibody (NBP1-80608)

Discover more about diseases related to ZNF350 Antibody (NBP1-80608).
 

Pathways for ZNF350 Antibody (NBP1-80608)

View related products by pathway.

PTMs for ZNF350 Antibody (NBP1-80608)

Learn more about PTMs related to ZNF350 Antibody (NBP1-80608).
 

Research Areas for ZNF350 Antibody (NBP1-80608)

Find related products by research area.

Blogs on ZNF350

There are no specific blogs for ZNF350, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF350 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF350
Entrez
Uniprot