ZNF436 Antibody

Images

 
Western Blot: ZNF436 Antibody [NBP1-82897] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZNF436 Antibody [NBP1-82897] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF436 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF436
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF436 Protein (NBP1-82897PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF436 Antibody

  • DKFZp686K08243
  • KRAB zinc finger protein HFB101
  • ZF2
  • zinc finger protein 274FLJ37843
  • Zinc finger protein HFB101
  • Zinc finger protein with KRAB and SCAN domains 19
  • Zinc finger protein zfp2
  • ZKSCAN19HFB101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20964
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-82866
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46835
Species: Hu
Applications: IHC, IHC-P
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
H00007558-R01
Species: Hu
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82013
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007702-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC-P
NBP1-81634
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-20322
Species: Hu
Applications: WB, ChIP, IP

Publications for ZNF436 Antibody (NBP1-82897) (0)

There are no publications for ZNF436 Antibody (NBP1-82897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF436 Antibody (NBP1-82897) (0)

There are no reviews for ZNF436 Antibody (NBP1-82897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF436 Antibody (NBP1-82897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF436 Products

Bioinformatics Tool for ZNF436 Antibody (NBP1-82897)

Discover related pathways, diseases and genes to ZNF436 Antibody (NBP1-82897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF436

There are no specific blogs for ZNF436, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF436 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF436