ZNF436 Antibody


Western Blot: ZNF436 Antibody [NBP1-82897] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZNF436 Antibody [NBP1-82897] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining in human cerebral cortex and pancreas tissues using anti-ZNF436 antibody. Corresponding ZNF436 RNA-seq data are ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ZNF436 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVH
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF436 Protein (NBP1-82897PEP)
Read Publication using
NBP1-82897 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ZNF436 Antibody

  • DKFZp686K08243
  • KRAB zinc finger protein HFB101
  • ZF2
  • zinc finger protein 274FLJ37843
  • Zinc finger protein HFB101
  • Zinc finger protein with KRAB and SCAN domains 19
  • Zinc finger protein zfp2
  • ZKSCAN19HFB101


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, IHC-P, IP, PLA, WB

Publications for ZNF436 Antibody (NBP1-82897)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ZNF436 Antibody (NBP1-82897) (0)

There are no reviews for ZNF436 Antibody (NBP1-82897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF436 Antibody (NBP1-82897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF436 Products

Bioinformatics Tool for ZNF436 Antibody (NBP1-82897)

Discover related pathways, diseases and genes to ZNF436 Antibody (NBP1-82897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF436

There are no specific blogs for ZNF436, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF436 Antibody and receive a gift card or discount.


Gene Symbol ZNF436