ZNF436 Antibody

Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining in human cerebral cortex and pancreas tissues using anti-ZNF436 antibody. Corresponding ZNF436 RNA-seq data are presented for the same tissues.

Western Blot: ZNF436 Antibody [NBP1-82897] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: ZNF436 Antibody [NBP1-82897] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ZNF436 Antibody [NBP1-82897] - Staining of human cerebral cortex shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZNF436 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SENEVNPKQEISEDVQFGTTSERPAENAEENPESEEGFESGDRSERQWGDLTAEEWVSYPLQPVTDLLVHKEVH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF436
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF436 Protein (NBP1-82897PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF436 Antibody

• DKFZp686K08243
• KRAB zinc finger protein HFB101
• ZF2
• zinc finger protein 274FLJ37843
• Zinc finger protein HFB101
• Zinc finger protein with KRAB and SCAN domains 19
• Zinc finger protein zfp2
• ZKSCAN19HFB101

Background

ZNF436 may be a transcriptional repressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF436 Antibody (NBP1-82897)(1)

Publication using NBP1-82897

• Wang J ZNF436 promotes tumor cell proliferation through transcriptional activation of BCL10 in glioma Biochem. Biophys. Res. Commun. 2019-08-06 [PMID: 31178130] (WB, Human)

Bioinformatics

• Gene Symbol: ZNF436