Home » FBXO7 » FBXO7 Antibodies » FBXO7 Antibody

FBXO7 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.
Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in transfected 293T cell line by FBXO7 polyclonal antibody. Lane 1: FBXO7 transfected lysate(57.42 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FBXO7 Antibody Summary

Immunogen
FBXO7 (AAH08361.1, 1 a.a. - 522 a.a.) full-length human protein. MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FBXO7
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional, Immunofluorescence, Immunohistochemistry-Paraffin
Publications
Read Publication using H00025793-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXO7 Antibody

  • F-box only protein 7
  • F-box protein 7
  • FBX
  • FBX07
  • FBX7
  • FBX7Fbx
  • FBXO7
  • PARK15
  • PARK15DKFZp686B08113
  • PKPS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATP13A2 Antibody
NB110-41486
Simple Western: ATP13A2 Antibody [NB110-41486] - Simple Western lane view shows a specific band for ATP13A2 in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: ATP13A2 Antibody [NB110-41486] - Detection of ATP13A2 in mouse brain membrane lysate.
Immunohistochemistry: ATP13A2 Antibody [NB110-41486] - Staining of neurons and neuropils using a concentration of 10ug/ml. Human brain, 40X.
(2 Publications)
Species: Hu, Mu
Applications: IHC, Simple Western, WB
PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Species: Hu, Mu
Applications: WB
Park7/DJ-1 Antibody
NB300-270
Immunohistochemistry-Paraffin: Park7/DJ-1 Antibody [NB300-270] - Park7(DJ-1) detected in paraffin embedded human cortex.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - Lysates of the human RPE cell lines ARPE-19 (lane 1) and D407 (lane 2), the mouse RPE cell line B6-RPE07 (lane 3), mouse primary RPE (lane 4) and mouse brain lysates (lane 5) were harvested and analyzed by immunoblot assay with DJ-1 antibody. The DJ-1 signal varied in intensity in each RPE cell culture. Each lane contained 20 ug of protein. Protein loads were confirmed in replicate blots probed with GAPDH. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - ARPE-19 and D407 monolayers were treated with increasing concentrations (0 to 800 uM) of H2O2 for 18 hrs (B), harvested, and analyzed by immunoblot assay with DJ-1 antibody (upper panel). Each lane contained 20 ug of protein. Protein loadings were confirmed in replicate blots probed with GAPDH (lower panel). A representative Western is shown. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence
(3 Reviews)
(20 Publications)
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC/CF
1 μg/lane of Recombinant Human SCF/c-kit Ligand was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 19 kDa.
Recombinant Human SCF/c-kit Ligand (Catalog # 255-SC/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 1-5 ng/mL.
(163 Publications)
Species: Hu
Applications: BA
PINK1 Antibody -
BSA Free
BC100-494
Immunohistochemistry-Paraffin: PINK1 Antibody [BC100-494] - Rabbit heart tissue. IHC-P image submitted by a verified customer review.
Western Blot: PINK1 Antibody [BC100-494] - Pathogenic mutants of Parkin are subjected to Ser65 phosphorylation. Phos-tag Western blotting for Parkin and Western blotting for PINK1 were performed using Parkin WT and a series of pathogenic mutants. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep01002) licensed under a CC-BY licence.
Knockdown Validated: PINK1 Antibody [BC100-494] - HEK293 cells were co-transfected with PINK1 siRNA (#1 or #2) or scrambled siRNA (scrambled) and untagged wild-type (WT) or Ser65Ala (S65A) mutant Parkin as indicated using TransFectin reagent (Bio-Rad). 48 hrs post-transfection, cells were treated with/without 10 uM CCCP for 3 h. 0.25 mg of 1% Triton whole-cell lysate were subjected to immunoprecipitation with GST-Parkin antibody (S966C) covalently coupled to protein G Sepharose and then immunoblotted with anti-phospho-Ser65 antibody in the presence of dephosphorylated peptide. 5% of the IP was immunoblotted with total anti-Parkin antibody. 0.25 mg of whole-cell lysates were immunoprecipitated with anti-PINK1 antibody (S085D) and immunoblotted with anti-PINK1 antibody. Representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/cgi/doi/10.1098/rsob.120080) licensed under a CC-BY licence.
(13 Reviews)
(204 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Sample(30 ug of whole cell lysate) A:293T 10% SDS PAGE, antibody diluted at 1:1000.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Skp1 Antibody
(JM27-37)
NBP2-67147
Flow Cytometry: Skp1 Antibody (JM27-37) [NBP2-67147] - Analysis of Hela cells with Skp1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ILT6/CD85e/LILRA3
Antibody
NBP1-98549
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Human OVCAR-3 Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1.0 ug/mL. Peptide Concentration: 2.0 ug/mL lysate. Quantity: 25 ug/lane.
Western Blot: ILT6/CD85e/LILRA3 Antibody [NBP1-98549] - Antibody Dilution: 1.0ug/ml Sample Tissue: Human Kidney.
(1 Review)
Species: Hu
Applications: WB
Cdk6 Antibody
NBP1-87262
Immunocytochemistry/Immunofluorescence: Cdk6 Antibody [NBP1-87262] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.
Western Blot: Cdk6 Antibody [NBP1-87262] - Analysis in human cell lines U2OS and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Analysis in human placenta and skeletal muscle tissues. Corresponding CDK6 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Parkin Antibody
[Unconjugated]
AF1438
Western blot shows lysates of Sf 21 S. frugiperda insect ovarian cell line mock transfected or transfected GST tagged Parkin. PVDF membrane was probed with 2 µg/mL of Goat Anti-Human Parkin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1438) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for GST tagged Parkin at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Parkin was detected in immersion fixed paraffin-embedded sections of human brain (cerebellum) using 15 µg/mL Goat Anti-Human Parkin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1438) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC, WB
Recombinant Human
CAC1 GST (N-Term) Pro ...
H00143384-P01
SDS-Page: Recombinant Human CAC1 Protein [H00143384-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse cerebellum. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559 diluted at 1:500. Blue: Fluoroshield with DAPI.
Western Blot: alpha-Synuclein Antibody [NBP2-15365] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with alpha Synuclein antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse hippocampus. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: NeuN, stained by NeuN antibody [2Q158] diluted at 1:500.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PANK2 Antibody
(OTI3H9)
NBP2-02677
Flow Cytometry: PANK2 Antibody (3H9) [NBP2-02677] - Analysis of Jurkat cells, using anti-PANK2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: PANK2 Antibody (3H9) [NBP2-02677] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-PANK2 antibody, and then analyzed by flow cytometry.
Western Blot: PANK2 Antibody (3H9) [NBP2-02677] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PANK2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PANK2.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SPG11 Antibody -
BSA Free
NBP1-76990
Western Blot: SPG11 Antibody [NBP1-76990] - Mouse heart tissue lysate with SPG11 antibody at (A) 0.5 and (B) 1 ug/mL.
Immunohistochemistry-Paraffin: SPG11 Antibody [NBP1-76990] - Mouse brain tissue with SPG11 antibody at 2.5 ug/mL.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
DLG7/HURP Antibody
NBP1-87976
Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human testis shows high expression.
Western Blot: DLG7/HURP Antibody [NBP1-87976] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZNF350 Antibody
NBP1-80608
Immunohistochemistry-Paraffin: ZNF350 Antibody [NBP1-80608] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
Western Blot: ZNF350 Antibody [NBP1-80608] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunocytochemistry/Immunofluorescence: ZNF350 Antibody [NBP1-80608] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Bone marrow
stromal cell antigen ...
AF4736
Western blot shows lysates of human kidney (cortex) tissue. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human CD157 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4736) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CD157 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(3 Publications)
Species: Hu
Applications: WB
Patched 2/PTCH2
Antibody - (First Ext ...
AF4078
Patched 2 was detected in immersion fixed paraffin-embedded sections of human basal cell carcinoma using 3 µg/mL Goat Anti-Human Patched 2 (First Extracellular Loop) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4078) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
WS‑1 human fetal skin fibroblast cell line was stained with Human Patched 2 (First Extracellular Loop) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4078, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
FBXO7 Antibody
H00025793-B01P
FBXO7 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBXO7 Antibody (H00025793-B01P)(1)


Reviews for FBXO7 Antibody (H00025793-B01P) (0)

There are no reviews for FBXO7 Antibody (H00025793-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBXO7 Antibody (H00025793-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO7 Products

Bioinformatics Tool for FBXO7 Antibody (H00025793-B01P)

Discover related pathways, diseases and genes to FBXO7 Antibody (H00025793-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO7 Antibody (H00025793-B01P)

Discover more about diseases related to FBXO7 Antibody (H00025793-B01P).
 

Pathways for FBXO7 Antibody (H00025793-B01P)

View related products by pathway.

PTMs for FBXO7 Antibody (H00025793-B01P)

Learn more about PTMs related to FBXO7 Antibody (H00025793-B01P).

Blogs on FBXO7

There are no specific blogs for FBXO7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FBXO7
Uniprot