FBXO7 Antibody

Images

 
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.
Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in transfected 293T cell line by FBXO7 polyclonal antibody. Lane 1: FBXO7 transfected lysate(57.42 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FBXO7 Antibody Summary

Immunogen
FBXO7 (AAH08361.1, 1 a.a. - 522 a.a.) full-length human protein. MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FBXO7
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is useful for Western Blot, Functional, Immunofluorescence, Immunohistochemistry-Paraffin
Publications
Read Publication using H00025793-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXO7 Antibody

  • F-box only protein 7
  • F-box protein 7
  • FBX
  • FBX07
  • FBX7
  • FBX7Fbx
  • FBXO7
  • PARK15
  • PARK15DKFZp686B08113
  • PKPS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
H00008398-D01P
Species: Hu, Mu
Applications: WB
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
BC100-494
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-87262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF1438
Species: Hu
Applications: WB, IHC
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76990
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-87976
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4736
Species: Hu
Applications: WB
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00025793-B01P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBXO7 Antibody (H00025793-B01P)(1)


Reviews for FBXO7 Antibody (H00025793-B01P) (0)

There are no reviews for FBXO7 Antibody (H00025793-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBXO7 Antibody (H00025793-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FBXO7 Products

Bioinformatics Tool for FBXO7 Antibody (H00025793-B01P)

Discover related pathways, diseases and genes to FBXO7 Antibody (H00025793-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO7 Antibody (H00025793-B01P)

Discover more about diseases related to FBXO7 Antibody (H00025793-B01P).
 

Pathways for FBXO7 Antibody (H00025793-B01P)

View related products by pathway.

PTMs for FBXO7 Antibody (H00025793-B01P)

Learn more about PTMs related to FBXO7 Antibody (H00025793-B01P).

Blogs on FBXO7

There are no specific blogs for FBXO7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO7
Uniprot