Home » FBXO7 » FBXO7 Antibodies » FBXO7 Antibody

FBXO7 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in human placenta.
Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: FBXO7 Antibody [H00025793-B01P] - Analysis of purified antibody to FBXO7 on formalin-fixed paraffin-embedded human testis. (antibody concentration 3 ug/ml)
Western Blot: FBXO7 Antibody [H00025793-B01P] - Analysis of FBXO7 expression in transfected 293T cell line by FBXO7 polyclonal antibody. Lane 1: FBXO7 transfected lysate(57.42 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FBXO7 Antibody Summary

Immunogen
FBXO7 (AAH08361.1, 1 a.a. - 522 a.a.) full-length human protein. MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FBXO7
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is useful for Western Blot, Functional, Immunofluorescence, Immunohistochemistry-Paraffin
Publications
Read Publication using H00025793-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXO7 Antibody

  • F-box only protein 7
  • F-box protein 7
  • FBX
  • FBX07
  • FBX7
  • FBX7Fbx
  • FBXO7
  • PARK15
  • PARK15DKFZp686B08113
  • PKPS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATP13A2 Antibody
NB110-41486
Western Blot: ATP13A2 Antibody [NB110-41486] - Detection of ATP13A2 in mouse brain membrane lysate.
Immunohistochemistry: ATP13A2 Antibody [NB110-41486] - Staining of neurons and neuropils using a concentration of 10ug/ml. Human brain, 40X.
Simple Western: ATP13A2 Antibody [NB110-41486] - Simple Western lane view shows a specific band for ATP13A2 in 0.5 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IHC
PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: WB
Park7/DJ-1 Antibody
NB300-270
Simple Western: Park7/DJ-1 Antibody [NB300-270] - Simple Western lane view shows a specific band for Park7 (DJ-1) in 0.05 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - Lysates of the human RPE cell lines ARPE-19 (lane 1) and D407 (lane 2), the mouse RPE cell line B6-RPE07 (lane 3), mouse primary RPE (lane 4) and mouse brain lysates (lane 5) were harvested and analyzed by immunoblot assay with DJ-1 antibody. The DJ-1 signal varied in intensity in each RPE cell culture. Each lane contained 20 ug of protein. Protein loads were confirmed in replicate blots probed with GAPDH. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Park7/DJ-1 Antibody [NB300-270] - Representative confocal micrographs of ARPE-19 monolayers plated on Transwells(R) and labeled with antibodies to DJ-1 (G,J) and COX IV (H,K). Under baseline conditions, there is very little colocalization between DJ-1 and COX IV, as observed in overlaid images (I); DJ-1 is mostly distributed through the cytoplasm (arrows). Upon oxidative stress induced by incubation with 400 uM H2O2 for 1 hr, DJ-1 staining is increased (arrowheads) in ARPE-19 (J) cultures. In cultures treated with H2O2 some DJ-1 re-distributed to mitochondria (arrowheads) and displayed significant colocalization with COX IV in overlaid images (L). Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence.
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
SCF/c-kit Ligand
[Unconjugated]
7466-SC/CF
SCF/c-kit Ligand [Unconjugated]
(3 Publications)
Species: Hu
PINK1 Antibody
BC100-494
Knockdown Validated: PINK1 Antibody [BC100-494] - HEK293 cells were co-transfected with PINK1 siRNA (#1 or #2) or scrambled siRNA (scrambled) and untagged wild-type (WT) or Ser65Ala (S65A) mutant Parkin as indicated using TransFectin reagent (Bio-Rad). 48 hrs post-transfection, cells were treated with/without 10 uM CCCP for 3 h. 0.25 mg of 1% Triton whole-cell lysate were subjected to immunoprecipitation with GST-Parkin antibody (S966C) covalently coupled to protein G Sepharose and then immunoblotted with anti-phospho-Ser65 antibody in the presence of dephosphorylated peptide. 5% of the IP was immunoblotted with total anti-Parkin antibody. 0.25 mg of whole-cell lysates were immunoprecipitated with anti-PINK1 antibody (S085D) and immunoblotted with anti-PINK1 antibody. Representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/cgi/doi/10.1098/rsob.120080) licensed under a CC-BY licence.
Western Blot: PINK1 Antibody [BC100-494] - Pathogenic mutants of Parkin are subjected to Ser65 phosphorylation. Phos-tag Western blotting for Parkin and Western blotting for PINK1 were performed using Parkin WT and a series of pathogenic mutants. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep01002) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: PINK1 Antibody [BC100-494] - Immunocytochemistry of PINK1 antibody (BC100-494 Lot G). HeLa cells were treated with valinomycin (1 uM for 24h) prior to being fixed in 10% buffered formalin for 10 min and permeabilized in 0.1% Triton X-100 in PBS for 10 min. Cells were incubated with BC100-494 at 20 ug/mL for 1h at room temperature, washed 3x in PBS and incubated with Alexa Fluor488 anti-rabbit secondary antibody. PINK1 (Green) was detected at the mitochondria. Tubulin (Red) was detected using an anti-tubulin antibody with an anti-mouse DyLight 550 secondary antibody. DNA (Blue) was counterstained with DAPI. Note: mitochondria staining might not be easily observed without treatment with valinomycin or CCCP.
(12 Reviews)
(177 Publications)
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
Skp1 Protein
NBP1-30173
SDS-Page: Recombinant Human Skp1 Protein [NBP1-30173] - 15% SDS-Page (3ug)
(1 Publication)
Species: Hu
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
(3 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu
Applications: WB, ELISA
Cdk6 Antibody
NBP1-87262
Western Blot: Cdk6 Antibody [NBP1-87262] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: Cdk6 Antibody [NBP1-87262] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cdk6 Antibody [NBP1-87262] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Parkin Antibody
[Unconjugated]
AF1438
Western blot shows lysates of Sf 21 S. frugiperda insect ovarian cell line mock transfected or transfected GST tagged Parkin. PVDF membrane was probed with 2 µg/mL of Goat Anti-Human Parkin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1438) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for GST tagged Parkin at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Parkin was detected in immersion fixed paraffin-embedded sections of human brain (cerebellum) using 15 µg/mL Goat Anti-Human Parkin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1438) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
Recombinant Human
CAC1 GST (N-Term) Pro ...
H00143384-P01
SDS-Page: Recombinant Human CAC1 Protein [H00143384-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
alpha-Synuclein
Antibody
NBP2-15365
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse hippocampus. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: NeuN, stained by NeuN antibody [2Q158] diluted at 1:500.
Western Blot: alpha-Synuclein Antibody [NBP2-15365] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membranes were blotted with alpha Synuclein antibody diluted at 1:2000 and competitor's antibody diluted at 1:2000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Frozen: alpha-Synuclein Antibody [NBP2-15365] - Frozen-sectioned adult mouse cerebellum. Green: alpha Synuclein protein stained by alpha Synuclein antibody diluted at 1:250. Red: beta Tubulin 3/ TUJ1, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559 diluted at 1:500. Blue: Fluoroshield with DAPI.
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
PANK2 Antibody
(OTI3H9)
NBP2-02677
Western Blot: PANK2 Antibody (3H9) [NBP2-02677] Analysis of extracts (35ug) from 9 different cell lines by using anti-PANK2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: PANK2 Antibody (3H9) [NBP2-02677] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY PANK2.
Immunohistochemistry-Paraffin: PANK2 Antibody (3H9) [NBP2-02677] - Staining of paraffin-embedded Human prostate tissue using anti-PANK2 mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
SPG11 Antibody
NBP1-76990
Western Blot: SPG11 Antibody [NBP1-76990] - Mouse heart tissue lysate with SPG11 antibody at (A) 0.5 and (B) 1 ug/mL.
Immunohistochemistry-Paraffin: SPG11 Antibody [NBP1-76990] - Mouse brain tissue with SPG11 antibody at 2.5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
DLG7/HURP Antibody
NBP1-87976
Western Blot: DLG7/HURP Antibody [NBP1-87976] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-DLGAP5 antibody. Corresponding DLGAP5 RNA-seq data are presented for the same cell lines. Loading control: anti-PPIB.
Immunocytochemistry/Immunofluorescence: DLG7/HURP Antibody [NBP1-87976] - Staining of human cell line A-431 shows localization to cytosol & microtubule organizing center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DLG7/HURP Antibody [NBP1-87976] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ZNF350 Antibody
NBP1-80608
Western Blot: ZNF350 Antibody [NBP1-80608] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
Immunocytochemistry/Immunofluorescence: ZNF350 Antibody [NBP1-80608] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: ZNF350 Antibody [NBP1-80608] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Bone marrow
stromal cell antigen ...
AF4736
Western blot shows lysates of human kidney (cortex) tissue. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human CD157 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4736) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CD157 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(3 Publications)
Species: Hu
Applications: WB
Patched 2/PTCH2
Antibody - (First Ext ...
AF4078
Patched 2 was detected in immersion fixed paraffin-embedded sections of human basal cell carcinoma using 3 µg/mL Goat Anti-Human Patched 2 (First Extracellular Loop) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4078) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
WS‑1 human fetal skin fibroblast cell line was stained with Human Patched 2 (First Extracellular Loop) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4078, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
FBXO7 Antibody
H00025793-B01P
FBXO7 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBXO7 Antibody (H00025793-B01P)(1)


Reviews for FBXO7 Antibody (H00025793-B01P) (0)

There are no reviews for FBXO7 Antibody (H00025793-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBXO7 Antibody (H00025793-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FBXO7 Products

Bioinformatics Tool for FBXO7 Antibody (H00025793-B01P)

Discover related pathways, diseases and genes to FBXO7 Antibody (H00025793-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO7 Antibody (H00025793-B01P)

Discover more about diseases related to FBXO7 Antibody (H00025793-B01P).
 

Pathways for FBXO7 Antibody (H00025793-B01P)

View related products by pathway.

PTMs for FBXO7 Antibody (H00025793-B01P)

Learn more about PTMs related to FBXO7 Antibody (H00025793-B01P).

Blogs on FBXO7

There are no specific blogs for FBXO7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FBXO7
Uniprot