ZNF143 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF143 Antibody [NBP2-57806] - Staining of human cell line HEK 293 shows localization to nucleoplasm & vesicles.

ChIP-Exo-Seq composite graph for Anti-ZNF143 (NBP2-57806) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF143 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF143 Antibody - BSA Free (NBP2-57806) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AVQVPQSDTILAIQADGTVAGLHTGDATIDPDTISALEQYAAKVSIDGSESVAGTGMIGENEQEKKMQIVLQGHATRVTAKSQQSG
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF143
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF143 Recombinant Protein Antigen (NBP2-57806PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF143 Antibody - BSA Free

• hStaf
• pHZ-1
• SBF
• SBFzinc finger protein 143 (clone pHZ-1)
• Selenocysteine tRNA gene transcription-activating factor
• SPH-binding factor
• STAF
• STAFpHZ-1
• transcriptional activator Staf
• zinc finger protein 143
• ZNF143

Background

ZNF143 is a human homolog of Xenopus transcriptional activator staf that is involved in selenocystyl tRNA transcription which binds to the SPH motif of small nuclear RNA (snRNA) gene promoters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF143