PKD2L1 Antibody (4F9)

Images

 
Western Blot: PKD2L1 Antibody (4F9) [H00009033-M01] - PKD2L1 monoclonal antibody (M01), clone 4F9. Analysis of PKD2L1 expression in rat brain.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, PAGE
Clone
4F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PKD2L1 Antibody (4F9) Summary

Immunogen
PKD2L1 (NP_057196.2, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KWYNNQSLGHGSHSFIYYENMLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPFNGTAWTYHSQDELGGFSHWGRLTSYSGGGYYL
Specificity
PKD2L1 - polycystic kidney disease 2-like 1 (4F9)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PKD2L1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • SDS-Page
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00009033-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKD2L1 Antibody (4F9)

  • PCL
  • PKD2Lpolycystin-L
  • PKDLpolycystin-L1
  • polycystic kidney disease 2-like 1 protein
  • polycystic kidney disease 2-like 1
  • Polycystin-2 homolog
  • polycystin-2L1
  • Polycystin-L
  • Polycystin-L1
  • transient receptor potential cation channel, subfamily P, member 3
  • TRPP3

Background

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Alternative splice variants have been described but their full length sequences have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90268
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB7265
Species: Mu
Applications: IHC, WB
H00005311-M01
Species: Hu
Applications: ELISA, ICC/IF, PLA, S-ELISA, WB
NBP1-52300
Species: Hu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
MAB2806
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-50247
Species: Hu
Applications: IHC, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-44448
Species: Bv, Fi, Hu, Pm, Mu, Po
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84597
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-84197
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: ICC/IF, WB

Publications for PKD2L1 Antibody (H00009033-M01)(1)


Reviews for PKD2L1 Antibody (H00009033-M01) (0)

There are no reviews for PKD2L1 Antibody (H00009033-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKD2L1 Antibody (H00009033-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PKD2L1 Products

Bioinformatics Tool for PKD2L1 Antibody (H00009033-M01)

Discover related pathways, diseases and genes to PKD2L1 Antibody (H00009033-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKD2L1 Antibody (H00009033-M01)

Discover more about diseases related to PKD2L1 Antibody (H00009033-M01).
 

Pathways for PKD2L1 Antibody (H00009033-M01)

View related products by pathway.

PTMs for PKD2L1 Antibody (H00009033-M01)

Learn more about PTMs related to PKD2L1 Antibody (H00009033-M01).

Blogs on PKD2L1

There are no specific blogs for PKD2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKD2L1 Antibody (4F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PKD2L1
Entrez
Uniprot