ZNF143 Antibody

Images

 
Immunohistochemistry: ZNF143 Antibody [NBP1-87278] - Staining of human lymph node shows moderate nuclear positivity in reaction center cells and lymphoid cells outside reaction center.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF143 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TQSGLSQQVTLISQDGTQHVNISQADMQAIGNTITMVTQDGTPITVPAHDAVISSAGTHSVAMVTAEGTEGQQVAIVAQDLAAFHTASSEMGHQQHSHHLVTTETRPLTLVATSNGTQIAVQLGEQPSLEEAIRIASRIQQGET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF143
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
ZNF143 Protein (NBP1-87278PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF143 Antibody

  • hStaf
  • pHZ-1
  • SBF
  • SBFzinc finger protein 143 (clone pHZ-1)
  • Selenocysteine tRNA gene transcription-activating factor
  • SPH-binding factor
  • STAF
  • STAFpHZ-1
  • transcriptional activator Staf
  • zinc finger protein 143
  • ZNF143

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84724
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP

Publications for ZNF143 Antibody (NBP1-87278) (0)

There are no publications for ZNF143 Antibody (NBP1-87278).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF143 Antibody (NBP1-87278) (0)

There are no reviews for ZNF143 Antibody (NBP1-87278). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF143 Antibody (NBP1-87278) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF143 Products

Bioinformatics Tool for ZNF143 Antibody (NBP1-87278)

Discover related pathways, diseases and genes to ZNF143 Antibody (NBP1-87278). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF143 Antibody (NBP1-87278)

Discover more about diseases related to ZNF143 Antibody (NBP1-87278).
 

Pathways for ZNF143 Antibody (NBP1-87278)

View related products by pathway.

PTMs for ZNF143 Antibody (NBP1-87278)

Learn more about PTMs related to ZNF143 Antibody (NBP1-87278).

Blogs on ZNF143

There are no specific blogs for ZNF143, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF143 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF143
Entrez