ZFR Antibody - BSA Free

Western Blot: ZFR Antibody [NBP1-80601] - Analysis in human cell line K562.

Immunocytochemistry/Immunofluorescence: ZFR Antibody [NBP1-80601] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ZFR Antibody [NBP1-80601] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans)

ChIP-Exo-Seq composite graph for Anti-ZFR tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NCTVNTSSIATSSMKGLTTTGNSSLNSTSNTKVSAVPTNMAAKKTSTPKINFVGGNKLQSTGNKAEDIKGTECVKSTPVTSAVQIPEVKQDTVSEPVTPASLAALQSDVQPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZFR Protein (NBP1-80601PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZFR Antibody - BSA Free

• FLJ41312
• hZFR
• zinc finger RNA binding protein

Background

ZFR is involved in postimplantation and gastrulation stages of development. Involved in the nucleocytoplasmic shuttling of STAU2. Binds to DNA and RNA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZFR Antibody (NBP1-80601)(1)

Publication using NBP1-80601

• Pieraccioli M, Caggiano C, Mignini L et al. The transcriptional terminator XRN2 and the RNA-binding protein Sam68 link alternative polyadenylation to cell cycle progression in prostate cancer Nature structural & molecular biology 2022-11-01 [PMID: 36344846] (WB, Human)

Bioinformatics

• Gene Symbol: ZFR
• Entrez:
  • 51663(Human)
• Uniprot:
  • Q96KR1(Human)