Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Analysis in human kidney and lymph node tissues. Corresponding SLC4A4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human pancreas shows strong membranous positivity in intercalated ducts.
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human lymph node shows no positivity as expected.
Immunohistochemistry-Paraffin: SLC4A4 Antibody [NBP2-32020] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Novus Biologicals Rabbit SLC4A4 Antibody - BSA Free (NBP2-32020) is a polyclonal antibody validated for use in IHC. Anti-SLC4A4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC4A4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
solute carrier family 4, sodium bicarbonate cotransporter, member 4
solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
solute carrier family 4, sodium bicarbonate cotransporter, member 5
Background
SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for SLC4A4 Antibody (NBP2-32020). (Showing 1 - 2 of 2 FAQs).
Have any of your SLC4A4 antibodies been tested for use in IHC?
The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.
Can I use this Ab for FACS? Or do you have some other Abs of SLC4a4(isotype1) recommend?
Our SLC4A4 antibody with catalogue number NBP2-32020 has not yet been evaluated for its suitability for FACS, and has only been tested for IHC with paraffin-embedded samples to date. We do not currently have an antibody to SLS4A4 that has been validated for FACS.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SLC4A4 Antibody - BSA Free and receive a gift card or discount.