SLC4A4 Antibody - BSA Free

Staining of human kidney shows strong cytoplasmic/ membranous positivity in cells in tubules.

Staining of human lymph node shows no positivity as expected.

Staining of human pancreas shows strong membranous positivity in intercalated ducts.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC4A4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTS
• Predicted Species: Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC4A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC4A4 Protein (NBP2-32020PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC4A4 Antibody - BSA Free

• electrogenic sodium bicarbonate cotransporter 1
• hhNMC
• HNBC1
• KNBC
• kNBC1
• Na(+)/HCO3(-) cotransporter
• NBC
• NBC1DKFZp781H1314
• NBC2
• NBCE1
• pNBC
• SLC4A5
• sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas)
• Sodium bicarbonate cotransporter
• Solute carrier family 4 member 4
• solute carrier family 4, sodium bicarbonate cotransporter, member 4
• solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type
• solute carrier family 4, sodium bicarbonate cotransporter, member 5

Background

SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC4A4 Antibody (NBP2-32020)(2)

Publications using NBP2-32020

• Wu L, Pandey V, Casha V et al. The cell-surface shared proteome of astrocytes and neurons and the molecular foundations of their multicellular interactions. Neuron 2025-06-05 [PMID: 40499536]
• Soto JS, Jami-Alahmadi Y, Chacon J et al. Astrocyte-neuron subproteomes and obsessive-compulsive disorder mechanisms Nature 2023-04-01 [PMID: 37046092] (IHC-Fr, Mouse)

FAQs for SLC4A4 Antibody (NBP2-32020). (Showing 1 - 2 of 2 FAQs).

1. Have any of your SLC4A4 antibodies been tested for use in IHC?
   • The SLC4A4 antibodies have not been tested, or validated in IHC at this time. We will guarantee all listed applications and species. Should you wish to test in this new application, we would recommend our <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>. Under the terms of this program, you are eligible for a full credit of the price of this antibody in exchange for your data on IHC use. Eligibility for the credit is regardless of positive or negative results, as the data is still useful.
2. Can I use this Ab for FACS? Or do you have some other Abs of SLC4a4(isotype1) recommend?
   • Our SLC4A4 antibody with catalogue number NBP2-32020 has not yet been evaluated for its suitability for FACS, and has only been tested for IHC with paraffin-embedded samples to date. We do not currently have an antibody to SLS4A4 that has been validated for FACS.

Bioinformatics

• Gene Symbol: SLC4A4
• Uniprot:
  • Q9Y6R1(Human)