XPR1 Antibody

Images

 
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Fallopian tube shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: XPR1 Antibody [NBP2-48531] - Staining of human Testis shows strong membranous and cytoplasmic positivity in spermatogonia and cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

XPR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XPR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
XPR1 Recombinant Protein Antigen (NBP2-48531PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for XPR1 Antibody

  • FLJ90308
  • Protein SYG1 homolog
  • SYG1xenotropic and polytropic retrovirus receptor
  • X3
  • Xenotropic and polytropic murine leukemia virus receptor X3
  • xenotropic and polytropic retrovirus receptor 1
  • XR
  • X-receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-62658
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90233
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92824
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-87828
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75554
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-48272
Species: Hu, Pm, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-48531
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for XPR1 Antibody (NBP2-48531) (0)

There are no publications for XPR1 Antibody (NBP2-48531).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPR1 Antibody (NBP2-48531) (0)

There are no reviews for XPR1 Antibody (NBP2-48531). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for XPR1 Antibody (NBP2-48531) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XPR1 Products

Bioinformatics Tool for XPR1 Antibody (NBP2-48531)

Discover related pathways, diseases and genes to XPR1 Antibody (NBP2-48531). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for XPR1 Antibody (NBP2-48531)

Discover more about diseases related to XPR1 Antibody (NBP2-48531).
 

Pathways for XPR1 Antibody (NBP2-48531)

View related products by pathway.

Research Areas for XPR1 Antibody (NBP2-48531)

Find related products by research area.

Blogs on XPR1

There are no specific blogs for XPR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XPR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XPR1