LMP7/PSMB8 Antibody (1B3)

Images

 
Western Blot: LMP7/PSMB8 Antibody (1B3) [H00005696-M01] - Analysis of PSMB8 expression in transfected 293T cell line by PSMB8 monoclonal antibody (M01), clone 1B3.Lane 1: PSMB8 transfected lysate(29.8 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: LMP7/PSMB8 Antibody (1B3) [H00005696-M01] - Analysis of monoclonal antibody to PSMB8 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: LMP7/PSMB8 Antibody (1B3) [H00005696-M01] - Analysis of monoclonal antibody to PSMB8 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Immunoprecipitation: LMP7/PSMB8 Antibody (1B3) [H00005696-M01] - Analysis of PSMB8 transfected lysate using anti-PSMB8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PSMB8 MaxPab rabbit ...read more
ELISA: LMP7/PSMB8 Antibody (1B3) [H00005696-M01] - Detection limit for recombinant GST tagged PSMB8 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LMP7/PSMB8 Antibody (1B3) Summary

Immunogen
PSMB8 (AAH01114, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Specificity
PSMB8 - proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional protease 7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMB8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:1000
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 27213585).
Control
LMP7/PSMB8 Knockout A549 Cell Lysate
Publications
Read Publications using
H00005696-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMP7/PSMB8 Antibody (1B3)

  • ALDD
  • beta5i
  • D6S216E
  • EC 3.4.25.1
  • JMP
  • LMP7
  • LMP7MGC1491
  • Low molecular mass protein 7
  • low molecular weight protein 7
  • Macropain subunit C13
  • Multicatalytic endopeptidase complex subunit C13
  • NKJO
  • protease component C13
  • proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7)
  • proteasome catalytic subunit 3i
  • Proteasome Component C13
  • proteasome subunit beta 5i
  • proteasome subunit beta type-8
  • Proteasome subunit beta-5i
  • Proteasome Subunit Y2
  • proteasome-related gene 7
  • PSMB5i
  • PSMB5iD6S216
  • PSMB8
  • Really interesting new gene 10 protein
  • RING10
  • RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7)
  • Y2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-93797
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-01817
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006890-M04
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88660
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu, Rt, Pm
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008615-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1538
Species: Hu, Rt, Ha
Applications: WB, IHC, IHC-P, IP, PEP-ELISA
NBP2-75606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC

Publications for LMP7/PSMB8 Antibody (H00005696-M01)(3)

Reviews for LMP7/PSMB8 Antibody (H00005696-M01) (0)

There are no reviews for LMP7/PSMB8 Antibody (H00005696-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LMP7/PSMB8 Antibody (H00005696-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LMP7/PSMB8 Products

Bioinformatics Tool for LMP7/PSMB8 Antibody (H00005696-M01)

Discover related pathways, diseases and genes to LMP7/PSMB8 Antibody (H00005696-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMP7/PSMB8 Antibody (H00005696-M01)

Discover more about diseases related to LMP7/PSMB8 Antibody (H00005696-M01).
 

Pathways for LMP7/PSMB8 Antibody (H00005696-M01)

View related products by pathway.

PTMs for LMP7/PSMB8 Antibody (H00005696-M01)

Learn more about PTMs related to LMP7/PSMB8 Antibody (H00005696-M01).
 

Research Areas for LMP7/PSMB8 Antibody (H00005696-M01)

Find related products by research area.

Blogs on LMP7/PSMB8

There are no specific blogs for LMP7/PSMB8, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMP7/PSMB8 Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMB8
Entrez
OMIM
Uniprot