Xanthine Oxidase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Xanthine Oxidase Antibody [NBP2-57577] - Staining of human cell line U-251 MG shows localization to nucleus & microtubule organizing center.
Immunohistochemistry-Paraffin: Xanthine Oxidase Antibody [NBP2-57577] - Staining of human lactating breast shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Xanthine Oxidase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK
Specificity
Specificity of human Xanthine Oxidase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XDH
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Xanthine Oxidase Recombinant Protein Antigen (NBP2-57577PEP)

Reactivity Notes

Mouse 87%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Xanthine Oxidase Antibody

  • EC 1.17.1.4
  • EC 1.7.2.2
  • xanthene dehydrogenase
  • xanthine dehydrogenase
  • xanthine dehydrogenase/oxidase
  • xanthine oxidase
  • xanthine oxidoreductase
  • XDHA
  • XO
  • XOR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-75520
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57577
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Xanthine Oxidase Antibody (NBP2-57577) (0)

There are no publications for Xanthine Oxidase Antibody (NBP2-57577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Xanthine Oxidase Antibody (NBP2-57577) (0)

There are no reviews for Xanthine Oxidase Antibody (NBP2-57577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Xanthine Oxidase Antibody (NBP2-57577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Xanthine Oxidase Products

Bioinformatics Tool for Xanthine Oxidase Antibody (NBP2-57577)

Discover related pathways, diseases and genes to Xanthine Oxidase Antibody (NBP2-57577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Xanthine Oxidase Antibody (NBP2-57577)

Discover more about diseases related to Xanthine Oxidase Antibody (NBP2-57577).
 

Pathways for Xanthine Oxidase Antibody (NBP2-57577)

View related products by pathway.

PTMs for Xanthine Oxidase Antibody (NBP2-57577)

Learn more about PTMs related to Xanthine Oxidase Antibody (NBP2-57577).
 

Research Areas for Xanthine Oxidase Antibody (NBP2-57577)

Find related products by research area.

Blogs on Xanthine Oxidase

There are no specific blogs for Xanthine Oxidase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Xanthine Oxidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XDH