WDHD1 Antibody

Images

 
Western Blot: WDHD1 Antibody [NBP1-89091] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Western Blot: WDHD1 Antibody [NBP1-89091] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
WDHD1 Protein (NBP1-89091PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89091 in the following applications:

Publications
Read Publications using
NBP1-89091 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDHD1 Antibody

  • Acidic nucleoplasmic DNA-binding protein 1
  • AND1
  • AND-1
  • CHTF4
  • CTF4
  • CTF4, chromosome transmission fidelity factor 4 homolog
  • WD repeat and HMG-box DNA binding protein 1
  • WD repeat and HMG-box DNA-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-253
Species: Hu
Applications: WB, IP
MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-85723
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
AF2147
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-85006
Species: Hu
Applications: IHC, IHC-P
NBP1-89091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for WDHD1 Antibody (NBP1-89091)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for WDHD1 Antibody (NBP1-89091) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-89091:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot WDHD1 NBP1-89091
Enlarge
reviewed by:
Anonymous
WB Human 11/11/2014
View

Summary

ApplicationWestern Blot
Sample TestedWhole cell lysates
SpeciesHuman
Lot89091

Blocking

Blocking Details5% Milk

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit HRP
Secondary Concentration1:1000

Details

Detection NotesDensitometry for 30 seconds

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WDHD1 Antibody (NBP1-89091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDHD1 Products

Bioinformatics Tool for WDHD1 Antibody (NBP1-89091)

Discover related pathways, diseases and genes to WDHD1 Antibody (NBP1-89091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDHD1 Antibody (NBP1-89091)

Discover more about diseases related to WDHD1 Antibody (NBP1-89091).
 

Pathways for WDHD1 Antibody (NBP1-89091)

View related products by pathway.

PTMs for WDHD1 Antibody (NBP1-89091)

Learn more about PTMs related to WDHD1 Antibody (NBP1-89091).
 

Research Areas for WDHD1 Antibody (NBP1-89091)

Find related products by research area.

Blogs on WDHD1

There are no specific blogs for WDHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
11/11/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol WDHD1
Entrez
Uniprot