WDHD1 Antibody - BSA Free

Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in human cell line RH-30.

WDHD1-Antibody-Western-Blot-NBP1-89091-img0018.jpg

Western Blot: WDHD1 Antibody [NBP1-89091] - DDX11 interacts with Pol δ independently of its FeS cluster.(A) Gene Ontology term enrichment analysis of interaction partners obtained upon pull-down of YFP-DDX11 from HeLa Flp-In T-REx cells. (B) Flag pull-down of over-expressed Flag-tagged DDX11 from 293T cells & co-immunoprecipitated endogenous proteins. (C) Reciprocal co-immunoprecipitations of Flag-tagged POLD1 & untagged DDX11, & Flag-tagged DDX11 & untagged POLD1, respectively, extracted from 293T cells. (D) Co-immunoprecipitations of Flag-tagged DDX11 variants & untagged POLD1 from 293T cells. See also Fig S3, Tables S1, & S2. WB, Western blot. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32071282), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, AND-1: red. Scale bar = 12.5 μm. (B) Dot plots of mean AND-1 intensity per nuclei in AFU for each cell line, as indicated. Black line & numbers below the graph indicate the mean AFU. Error bars indicate the ±SEM of three independent biological experiments. (C) Western blot analysis showing chromatin fractions from HCT116 cells. Ponceau S & histone H3 were used as loading controls. AND-1 & pol alpha levels were normalized to H3 levels & then normalized to the shNT control. (D) Co-IP was performed with Flag or HA antibody in cell lysates from HEK 293T cells, as indicated. 5% input was loaded as a control. For +HU samples in (B) & (D), HU was added 2 h before collection. Data are representative of three independent biological experiments. n indicates the number of total nuclei scored. P-values were calculated by an unpaired, two-tailed Mann–Whitney test in (B) & t test in (C) (****P ≤ 0.0001, **P ≤ 0.01). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30979824), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Analysis in human testis and liver tissues. Corresponding RNA-seq data are presented for the same tissues.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human lymph node shows strong nuclear positivity in germinal center cells.

Staining of human rectum shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDHD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDHD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
• Theoretical MW: 126 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  WDHD1 Protein (NBP1-89091PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WDHD1 Antibody - BSA Free

• Acidic nucleoplasmic DNA-binding protein 1
• AND1
• AND-1
• CHTF4
• CTF4
• CTF4, chromosome transmission fidelity factor 4 homolog
• WD repeat and HMG-box DNA binding protein 1
• WD repeat and HMG-box DNA-binding protein 1

Background

WDHD1 is encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDHD1 Antibody (NBP1-89091)(7)

Publications using NBP1-89091

• Zhou S, Zhang Y, Li Z et al. And-1 coordinates with polymerase δ to regulate nucleotide excision repair and UVB-induced skin tumorigenesis Nature Communications 2025-10-21 [PMID: 41120356]
• Scaramuzza, S;Jones, RM;Sadurni, MM;Reynolds-Winczura, A;Poovathumkadavil, D;Farrell, A;Natsume, T;Rojas, P;Cuesta, CF;Kanemaki, MT;Saponaro, M;Gambus, A; TRAIP resolves DNA replication-transcription conflicts during the S-phase of unperturbed cells Nature communications 2023-08-21 [PMID: 37604812]
• Ana G, Bernardo O, Marco N et al. Micronuclei from misaligned chromosomes that satisfy the spindle assembly checkpoint in cancer cells. Curr Biol. 2022-08-27 [PMID: 36057259]
• Simon AK, Kummer S, Wild S et al. The iron-sulfur helicase DDX11 promotes the generation of single-stranded DNA for CHK1 activation Life Sci Alliance 2020-03-01 [PMID: 32071282] (WB, Human)
• Wang Y, Brady K S et al. Human CST suppresses origin licensing and promotes AND-1/Ctf4 chromatin association. Life Sci Alliance 2019-01-04 [PMID: 30979824] (ICC/IF, WB, Human)
• Chen Y, Liu H, Zhang H et al. And-1 coordinates with CtIP for efficient homologous recombination and DNA damage checkpoint maintenance. Nucleic Acids Res. 2016-12-09 [PMID: 27940552] (ICC/IF, WB, Human)
• Sato N, Koinuma J, Fujita M et al. Activation of WD repeat and high-mobility group box DNA binding protein 1 in pulmonary and esophageal carcinogenesis. Clin Cancer Res 2010-01-01 [PMID: 20028748]

Review for WDHD1 Antibody (NBP1-89091) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 11/11/2014

Summary

• Application: Western Blot
• Sample Tested: Whole cell lysates
• Species: Human
• Lot: 89091

Bioinformatics

• Gene Symbol: WDHD1
• Entrez:
  • 11169(Human)
• Uniprot:
  • O75717(Human)