Orthogonal Strategies: Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining in human testis and liver tissues.. Corresponding WDHD1 RNA-seq data are presented for the same tissues.
Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human testis shows nuclear positivity in cells in seminiferous ducts.
Western Blot: WDHD1 Antibody [NBP1-89091] - Analysis in human cell line RH-30.
Western Blot: WDHD1 Antibody [NBP1-89091] - The interaction of DDX11 with WDHD1 does not depend on FeS cluster binding. Reciprocal co-immunoprecipitations of Flag-tagged WDHD1 and untagged DDX11, and Flag-tagged DDX11 ...read more
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human liver shows no positivity in hepatocytes.
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: WDHD1 Antibody [NBP1-89091] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Western Blot: WDHD1 Antibody [NBP1-89091] - DDX11 interacts with Pol δ independently of its FeS cluster.(A) Gene Ontology term enrichment analysis of interaction partners obtained upon pull-down of YFP-DDX11 from HeLa ...read more
Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, ...read more
Immunocytochemistry/ Immunofluorescence: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure ...read more
Western Blot: WDHD1 Antibody [NBP1-89091] - CST is required for AND-1 & pol alpha chromatin association.(A) Representative images of pre-extracted HeLa cells used to measure chromatin-associated AND-1. DAPI: blue, ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: QTLNIVTWSPCGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLLENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDHD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Theoretical MW
126 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
WDHD1 is encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.