CDC7 Antibody


Immunocytochemistry/ Immunofluorescence: CDC7 Antibody [NBP2-32708] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle.
Immunohistochemistry: CDC7 Antibody [NBP2-32708] - Staining of human stomach, upper shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CDC7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY
Specificity of human CDC7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC7 Protein (NBP2-32708PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDC7 Antibody

  • CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1
  • CDC7 cell division cycle 7 (S. cerevisiae)
  • CDC7L1MGC117361
  • CDC7-related kinase
  • cell division cycle 7 (S. cerevisiae)
  • cell division cycle 7 homolog (S. cerevisiae)
  • cell division cycle 7-like protein 1
  • cell division cycle 7-related protein kinase
  • EC
  • HsCDC7
  • Hsk1
  • huCdc7
  • MGC126237
  • MGC126238


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Rt
Applications: WB, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, IP, PLA
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Xp
Applications: WB, IHC, IP, PLA
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CDC7 Antibody (NBP2-32708) (0)

There are no publications for CDC7 Antibody (NBP2-32708).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC7 Antibody (NBP2-32708) (0)

There are no reviews for CDC7 Antibody (NBP2-32708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDC7 Antibody (NBP2-32708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDC7 Products

Bioinformatics Tool for CDC7 Antibody (NBP2-32708)

Discover related pathways, diseases and genes to CDC7 Antibody (NBP2-32708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC7 Antibody (NBP2-32708)

Discover more about diseases related to CDC7 Antibody (NBP2-32708).

Pathways for CDC7 Antibody (NBP2-32708)

View related products by pathway.

PTMs for CDC7 Antibody (NBP2-32708)

Learn more about PTMs related to CDC7 Antibody (NBP2-32708).

Research Areas for CDC7 Antibody (NBP2-32708)

Find related products by research area.

Blogs on CDC7

There are no specific blogs for CDC7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDC7 Antibody and receive a gift card or discount.


Gene Symbol CDC7