CDC7 Antibody


Immunocytochemistry/ Immunofluorescence: CDC7 Antibody [NBP2-32708] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle. Antibody stainng is shown in green.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human stomach, upper shows moderate nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

CDC7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY
Specificity of human CDC7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC7 Protein (NBP2-32708PEP)
Reviewed Applications
Read 1 Review rated 2
NBP2-32708 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDC7 Antibody

  • CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1
  • CDC7 cell division cycle 7 (S. cerevisiae)
  • CDC7L1MGC117361
  • CDC7-related kinase
  • cell division cycle 7 (S. cerevisiae)
  • cell division cycle 7 homolog (S. cerevisiae)
  • cell division cycle 7-like protein 1
  • cell division cycle 7-related protein kinase
  • EC
  • HsCDC7
  • Hsk1
  • huCdc7
  • MGC126237
  • MGC126238


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CDC7 Antibody (NBP2-32708) (0)

There are no publications for CDC7 Antibody (NBP2-32708).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CDC7 Antibody (NBP2-32708) (1) 21

Average Rating: 2
(Based on 1 review)
We have 1 review tested in 1 species: HCT116 cells.

Reviews using NBP2-32708:
Filter by Applications
Simple Western
All Applications
Filter by Species
HCT116 cells
All Species
Images Ratings Applications Species Date Details
Simple Western CDC7 NBP2-32708
reviewed by:
Simple Western HCT116 cells 08/27/2020


ApplicationSimple Western
Sample Testedwhole cell lysate,HCT116 whole cell lysate
SpeciesHCT116 cells


Comments10 fold primary Ab dilution; 0.8mg/ml lysate conc
*Low Rating Note: Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDC7 Antibody (NBP2-32708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional CDC7 Products

Bioinformatics Tool for CDC7 Antibody (NBP2-32708)

Discover related pathways, diseases and genes to CDC7 Antibody (NBP2-32708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC7 Antibody (NBP2-32708)

Discover more about diseases related to CDC7 Antibody (NBP2-32708).

Pathways for CDC7 Antibody (NBP2-32708)

View related products by pathway.

PTMs for CDC7 Antibody (NBP2-32708)

Learn more about PTMs related to CDC7 Antibody (NBP2-32708).

Research Areas for CDC7 Antibody (NBP2-32708)

Find related products by research area.

Blogs on CDC7

There are no specific blogs for CDC7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: Simple Western
Species: HCT116 cells


Gene Symbol CDC7