MCM10 Antibody

Images

 
Western Blot: MCM10 Antibody [NBP1-92102] - Analysis in control (vector only transfected HEK293T lysate) and MCM10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MCM10 Antibody [NBP1-92102] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: MCM10 Antibody [NBP1-92102] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: MCM10 Antibody [NBP1-92102] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry: MCM10 Antibody [NBP1-92102] - Staining of human lymph node shows strong nuclear positivity in a subset of non-germinal center cells.
Immunohistochemistry-Paraffin: MCM10 Antibody [NBP1-92102] - Staining of human small intestine shows strong positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCM10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QTTLSNLVVKGTNLIIQETRQKLGIPQKSLSCSEEFKELMDLPTCGARNLKQHLAKATASGIMGSPKPAIKSISASALLKQQKQRMLEMRRRKSEEIQK
Specificity
Specificity of human MCM10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCM10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MCM10 Protein (NBP1-92102PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCM10 Antibody

  • CNA43homolog of yeast MCM10
  • DNA43
  • hsMCM10
  • MCM10 minichromosome maintenance deficient 10 (S. cerevisiae)
  • MCM10 minichromosome maintenance deficient 10
  • MGC126776
  • minichromosome maintenance complex component 10
  • PRO2249
  • protein MCM10 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP2-67897
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-46403
Species: Hu
Applications: IHC, IHC-P
NB100-59829
Species: Hu, Mu
Applications: WB, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-93674
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
H00004999-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-06099
Species: Hu
NBP2-15837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33105
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2567
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-75569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-92102
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MCM10 Antibody (NBP1-92102) (0)

There are no publications for MCM10 Antibody (NBP1-92102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM10 Antibody (NBP1-92102) (0)

There are no reviews for MCM10 Antibody (NBP1-92102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM10 Antibody (NBP1-92102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MCM10 Products

Bioinformatics Tool for MCM10 Antibody (NBP1-92102)

Discover related pathways, diseases and genes to MCM10 Antibody (NBP1-92102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM10 Antibody (NBP1-92102)

Discover more about diseases related to MCM10 Antibody (NBP1-92102).
 

Pathways for MCM10 Antibody (NBP1-92102)

View related products by pathway.

PTMs for MCM10 Antibody (NBP1-92102)

Learn more about PTMs related to MCM10 Antibody (NBP1-92102).
 

Research Areas for MCM10 Antibody (NBP1-92102)

Find related products by research area.

Blogs on MCM10

There are no specific blogs for MCM10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCM10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM10