CDC45L Antibody

Images

 
Western Blot: CDC45L Antibody [NBP1-85723] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 Lane 3: Human cell line EFO-21 Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: ...read more
Immunocytochemistry/ Immunofluorescence: CDC45L Antibody [NBP1-85723] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome.
Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC45L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC45
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC45L Protein (NBP1-85723PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC45L Antibody

  • CDC45 cell division cycle 45-like (S. cerevisiae)
  • cell division cycle 45 homolog (S. cerevisiae)
  • cell division cycle 45-like 2
  • human CDC45
  • S.cerevisiae, homolog)-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB92171
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-288
Species: Hu, Xp
Applications: WB, IHC, IHC-P, IP, PLA
NB200-581
Species: Hu, Rt
Applications: WB, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-253
Species: Hu
Applications: WB, IP
NB100-290
Species: Hu, Mu, Xp
Applications: IP (-), WB, IHC, PLA
NB100-79778
Species: Hu, Xp
Applications: WB, IHC, PLA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NB100-2567
Species: Hu
Applications: WB, IHC-P, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP2-33825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDC45L Antibody (NBP1-85723) (0)

There are no publications for CDC45L Antibody (NBP1-85723).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC45L Antibody (NBP1-85723) (0)

There are no reviews for CDC45L Antibody (NBP1-85723). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDC45L Antibody (NBP1-85723) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC45L Products

Bioinformatics Tool for CDC45L Antibody (NBP1-85723)

Discover related pathways, diseases and genes to CDC45L Antibody (NBP1-85723). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC45L Antibody (NBP1-85723)

Discover more about diseases related to CDC45L Antibody (NBP1-85723).
 

Pathways for CDC45L Antibody (NBP1-85723)

View related products by pathway.

PTMs for CDC45L Antibody (NBP1-85723)

Learn more about PTMs related to CDC45L Antibody (NBP1-85723).
 

Research Areas for CDC45L Antibody (NBP1-85723)

Find related products by research area.

Blogs on CDC45L

There are no specific blogs for CDC45L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC45L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC45