Villin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human colon, gallbladder, kidney and liver using Anti-VIL1 antibody NBP1-85336 (A) shows similar protein distribution across tissues to independent antibody NBP1-85335 (B).

Western Blot: Villin 1 Antibody [NBP1-85336] - Analysis using Anti-VIL1 antibody NBP1-85336 (A) shows similar pattern to independent antibody NBP1-85335 (B).

Immunocytochemistry/Immunofluorescence: Villin 1 Antibody [NBP1-85336] - Staining of human cell line CACO-2 shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human colon.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human pancreas shows weak to moderate positivity in luminal membranes in exocrine glandular cells.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human liver.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human gallbladder.

Immunohistochemistry-Paraffin: Villin 1 Antibody [NBP1-85336] - Staining of human kidney using Anti-VIL1 antibody NBP1-85336.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Villin 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Villin 1 Antibody - BSA Free (NBP1-85336) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Villin 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLEQLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VIL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Villin 1 Protein (NBP1-85336PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Villin 1 Antibody - BSA Free

• D2S1471
• VIL
• villin 1
• villin-1

Background

Villin 1 encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Villin 1 Antibody (NBP1-85336)(1)

Publication using NBP1-85336

• Andersson S, Konrad A, Ashok N et al. Antibodies Biotinylated Using a Synthetic Z-domain from Protein A Provide Stringent In Situ Protein Detection. J Histochem Cytochem 2013-11-01 [PMID: 23920108]

Bioinformatics

• Gene Symbol: VIL1