The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human CHRNG. Peptide sequence NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNG
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 1 using NBP1-79952 in the following application:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for Nicotinic Acetylcholine Receptor gamma Antibody
acetylcholine receptor subunit gamma
acetylcholine receptor, muscle, gamma subunit
ACHRG
cholinergic receptor, nicotinic, gamma
CHRNG
Nicotinic Acetylcholine R gamma
nicotinic, gamma polypeptide
Background
After binding acetylcholine, the acetylcholine receptor responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Human iPSC Motor Neurons,Human NMJ containing organoid
Species
Human
Lot
QC6976-40851
Comments
Comments
***Novus Innovators Program - new species or application used on a primary antibody.*** Neuromuscular junction (NMJ) organoids were fixed in 4% PFA for 3h and subsequently washed 3x with PBS. Cryoprotection was carried out by incubation in 30% Sucrose overnight, followed by embedding in a 1:1 mixture of 30% Sucrose:OCT and cryosection into 20m slices, collected on superfrost glass slides. For IF staining, samples were incubated for 10min with 0.25% Triton X-100 to ensure membrane permeabilization, followed by blocking with 5% bovine serum albumin, 0.25% Triton X-100 in PBS for 1h, RT to avoid unspecific binding of primary antibodies. Subsequently, samples were incubated with primary antibodies in blocking solution overnight, 4C. The following day, samples were washed 2x with PBS and 1x with PBS-T (0.1% Tween 20) and incubated with appropriate fluorescent secondary antibodies for 1h, RT. Nuclei were counter stained with DAPI for 10min, followed by subsequent washing with 2x PBS and 1x PBS-T. Samples were mounted using Fluorosave. Images were taken with Zeiss LSMZ10 confocal microscope and analysed using Fiji/ImageJ.
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952). (Showing 1 - 1 of 1 FAQ).
I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.
Bioinformatics Tool for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952)
Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952)
Discover more about diseases related to Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.