Nicotinic Acetylcholine Receptor gamma Antibody

Images

 
Western Blot: Nicotinic Acetylcholine Receptor gamma Antibody [NBP1-79952] - MCF-7 whole cell lysates, concentration 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine Receptor gamma Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human CHRNG. Peptide sequence NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CHRNG and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nicotinic Acetylcholine Receptor gamma Antibody

  • acetylcholine receptor subunit gamma
  • acetylcholine receptor, muscle, gamma subunit
  • ACHRG
  • cholinergic receptor, nicotinic, gamma
  • nicotinic, gamma polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57262
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61674
Species: Hu
Applications: WB, ELISA
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75707
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02073
Species: Hu, Mu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79951
Species: Hu
Applications: WB
AF3445
Species: Mu
Applications: WB, IHC
NBP1-79948
Species: Hu, Rt
Applications: WB
NBP1-84752
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP2-61666
Species: Hu
Applications: WB, ELISA, Flow
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-80090
Species: Hu
Applications: WB

Publications for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952) (0)

There are no publications for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952) (0)

There are no reviews for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952)

Discover more about diseases related to Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952).
 

Pathways for Nicotinic Acetylcholine Receptor gamma Antibody (NBP1-79952)

View related products by pathway.

Blogs on Nicotinic Acetylcholine Receptor gamma

There are no specific blogs for Nicotinic Acetylcholine Receptor gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine Receptor gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNG
Uniprot