SMARCA6 Antibody

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Analysis in human testis and pancreas tissues. Corresponding HELLS RNA-seq data are presented for the same tissues.

Western Blot: SMARCA6 Antibody [NBP2-38986] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: SMARCA6 Antibody [NBP2-38986] - Staining of human cell line MCF7 shows localization to nucleus, the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human pancreas shows no positivity as expected.

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMARCA6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HELLS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMARCA6 Protein (NBP2-38986PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SMARCA6 Antibody

• EC 3.6.1
• EC 3.6.4.-
• helicase, lymphoid-specific
• LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin
• Nbla10143
• PASGFLJ10339
• Proliferation-associated SNF2-like protein
• SMARCA6lymphoid-specific helicase
• subfamily A, member 6
• SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6

Background

HELLS, also known as LSH (lymphoid specific helicase), is a member of the SNF2 superfamily of chromatin helicases. HELLS is ubiquitously expressed and is required for the maintenance of normal DNA methylation patterns important to organism development. HELLS function has also been shown to be important to the regulation of proliferation and the expression of senescence-related genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HELLS
• Uniprot:
  • Q9NRZ9(Human)