VIAAT/SLC32A1/VGAT Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
| Predicted Species |
Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC32A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VIAAT/SLC32A1/VGAT Antibody - BSA Free
Background
The Vesicular GABA Amino Acid Transporter (VGAT) is responsible for transport of the inhibitory neurotransmitter into synaptic vesicles(McIntire et al., 1997). The VGAT protein (also known as the Vesicular Inhibitory Amino Acid Transporter or VIAAT) is expressed in synaptic vesicles of both glycine and GABAergic synapses throughout the CNS (Chaudhry et al., 1998). Expression of the VGAT protein changes during development and also in response to patterns of neuronal activity (De et al., 2005).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Publications for VIAAT/SLC32A1/VGAT Antibody (NBP2-34117) (0)
There are no publications for VIAAT/SLC32A1/VGAT Antibody (NBP2-34117).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VIAAT/SLC32A1/VGAT Antibody (NBP2-34117) (0)
There are no reviews for VIAAT/SLC32A1/VGAT Antibody (NBP2-34117).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for VIAAT/SLC32A1/VGAT Antibody (NBP2-34117) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VIAAT/SLC32A1/VGAT Products
Research Areas for VIAAT/SLC32A1/VGAT Antibody (NBP2-34117)
Find related products by research area.
|
Blogs on VIAAT/SLC32A1/VGAT