GlyT2/SLC6A5 Antibody

Images

 
Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - Host: Rabbit. Target Name: SLC6A5. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653] - Rabbit Anti-SLC6A5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody ...read more
Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mL. Sample Type: Human heart

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

GlyT2/SLC6A5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human GlyT2/SLC6A5. Peptide sequence: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GlyT2/SLC6A5 Antibody

  • Glycine Transporter-2
  • GlyT2
  • GLYT-2
  • GLYT2GlyT-2
  • HKPX3
  • NET1
  • SLC6A5
  • sodium- and chloride-dependent glycine transporter 2
  • solute carrier family 6 (neurotransmitter transporter, glycine), member 5
  • Solute carrier family 6 member 5

Background

SLC6A5 - solute carrier family 6 (neurotransmitter transporter, glycine), member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GlyT2/SLC6A5 Antibody (NBP2-86653) (0)

There are no publications for GlyT2/SLC6A5 Antibody (NBP2-86653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GlyT2/SLC6A5 Antibody (NBP2-86653) (0)

There are no reviews for GlyT2/SLC6A5 Antibody (NBP2-86653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GlyT2/SLC6A5 Antibody (NBP2-86653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GlyT2/SLC6A5 Products

Research Areas for GlyT2/SLC6A5 Antibody (NBP2-86653)

Find related products by research area.

Blogs on GlyT2/SLC6A5

There are no specific blogs for GlyT2/SLC6A5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GlyT2/SLC6A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A5