GAT3 Antibody - BSA Free

Western Blot: GAT3 Antibody [NBP1-91920] - Analysis in human cerebral cortex tissue.

Immunohistochemistry-Paraffin: GAT3 Antibody [NBP1-91920] - Staining of human Cerebellum shows strong positivity in processes in cells in molecular layer.

Immunohistochemistry-Paraffin: GAT3 Antibody [NBP1-91920] - Staining of human Cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: GAT3 Antibody [NBP1-91920] - Staining of human Testis shows moderate cytoplasmic positivity in Leydig cells.

Staining of human Liver shows no positivity in hepatocytes as expected.

Analysis in human cerebral cortex tissue.

Glutamate and GABA transporter levels in the synaptosomal fraction. (A) Representative western blots of glutamate and GABA transporter protein expression in wild-type, wild-type/dnSNARE, BACHD and BACHD/dnSNARE mice. (B) Western blot quantification of the transporters (shown are n=3 independent samples). HTT was probed to confirm the genotype of sample mice on the same blot probed for GAT1 (same beta -actin loading control as shown for GAT1). No significant difference was observed in GLT1, GAT3 and GAT1 (n=5-6/genotype). Data are mean+/-s.e.m. Differences among the groups were assessed by one-way ANOVA followed by Tukey's HSD multiple comparison procedure. Non-significant P-values are not displayed on graphs. Refer to Table 1 for all P-values. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/39526491), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Expression of neurotransmitter transporters. (A,B) Representative RNAscope images of Slc6a1, Slc6a11and Gja1 in the striatum. Scale bars: 50 μm. The numbers of Gja1-positive cells co-labeled with Slc6a1 (encoding GAT1) or Slc6a11 (encoding GAT3) were counted. (C) Representative western blots of GLT1, GAT3 and GAT1 protein expression in the striatum of wild-type, wild-type/dnSNARE, BACHD and BACHD/dnSNARE mice (each lane represents a single sample; each sample is pooled from three mice of the same genotype). (D) Western blot quantification of GLT1, GAT3 and GAT1 (n=6/genotype). WT, wild type. The loading control beta -actin shown for GAT1 in C is the same as the beta -actin shown for Cx43 in Fig. 5A. The same membrane was probed for beta -actin, GAT1 and Cx43. The loading control beta -actin shown for GLT1 in C is the same as the beta -actin used for GFAP in Fig. 5A. GLT1 and GFAP were probed on the same blot membrane. Data are mean+/-s.e.m. Differences among the groups were assessed by one-way ANOVA followed by Tukey's HSD multiple comparison procedure. Non-significant P-values are not displayed on graphs. Refer to Table 1 for all P-values. Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/39526491), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAT3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GAT3 Protein (NBP1-91920PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for GAT3 Antibody - BSA Free

• GABA Transporter 3
• GABT3
• GAT-3
• GAT3sodium- and chloride-dependent GABA transporter 3
• GAT4
• solute carrier family 6 (neurotransmitter transporter, GABA), member 11
• Solute carrier family 6 member 11

Background

Gamma-aminobutyric acid (GABA) is the primary inhibitory neurotransmitter in the central nervous system, causing a hyperpolarization of the membrane through the opening of a Cl negative channel associated with the GABAA receptor (GABAA-R) subtype. GABA plasma membrane transporters (GATs) influence synaptic neurotransmission by high-affinity uptake and release of GABA. To date, four distinct GABA transporters have been identified: GAT-1, GAT-2, GAT-3, and BGT-1. GAT-3 has been found to be localized to astrocytes within the cerebral cortex indicating that this transporter mediates GABA uptake into glial cells (Minelli et al., 1996).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GAT3 Antibody (NBP1-91920)(1)

Publication using NBP1-91920

• King AC, Payne E, Stephens E et Al. Modulation of SNARE-dependent exocytosis in astrocytes improves neuropathology in Huntington's disease Dis Model Mech 2024-11-01 [PMID: 39526491]

Bioinformatics

• Gene Symbol: SLC6A11