Home » Versican » Versican Antibodies » Versican Antibody

Versican Antibody

 (6 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human stomach shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human tonsil shows no positivity as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Versican Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCAN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25593993). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Versican Protein (NBP1-85432PEP)
Publications
Read Publications using
NBP1-85432 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34178974). Human reactivity reported in scientific literature (PMID: 25593993).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Versican Antibody

  • Chondroitin sulfate proteoglycan 2WGN
  • Chondroitin sulfate proteoglycan core protein 2
  • CSPG2
  • CSPG2DKFZp686K06110
  • ERVR
  • GHAP
  • Glial hyaluronate-binding protein
  • Large fibroblast proteoglycan
  • PG-M
  • PG-MWGN1
  • VCAN
  • versican core protein
  • versican proteoglycan
  • Versican

Background

Versican is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Decorin Antibody
[Unconjugated]
AF143
Western blot shows lysates of human uterus tissue and human heart tissue. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Decorin at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human uterus and human heart tissue, loaded at 0.2 mg/mL. A specific band was detected for Decorin at approximately 140-149 kDa (as indicated) using 5 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
Decorin was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to intralobular stromal tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(20 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in U2OS cell lysate.
Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in L929 whole cell extract using NB100-74350.
Immunocytochemistry/Immunofluorescence: Aggrecan Neoepitope Antibody [NB100-74350] - Detection of ACAN in OA cartilage using NB100-74350.
(25 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Biglycan Antibody
AF2667
Biglycan was detected in immersion fixed paraffin-embedded sections of human kidney array using Human Biglycan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2667) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(8 Publications)
Species: Hu
Applications: IHC, WB
CD44 Antibody
(8E2F3) - BSA Free
NBP1-47386
Flow (Intracellular): CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(17 Publications)
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Neurocan Antibody
AF5800
Western blot shows lysates of rat embryonic hippocampal neurons. PVDF membrane was probed with 1 µg/mL of Mouse/Rat Neurocan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5800) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurocan at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Neurocan was detected in perfusion fixed frozen sections of mouse brain (medulla) using Mouse/Rat Neurocan Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5800) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(10 Publications)
Species: Mu, Rt
Applications: IHC, WB
Brevican Antibody
[Unconjugated]
AF4009
Western blot shows lysates of human brain (cerebellum) tissue and human brain (motor cortex) tissue. PVDF membrane was probed with 0.1 µg/mL of Sheep Anti-Human/Rat Brevican Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4009) followed by HRP-conjugated Donkey Anti-Sheep IgG HRP-conjugated Antigen Affinity-purified Polyclonal Antibody (Catalog # HAF016) . Specific bands were detected for Brevican at approximately 60 and 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Brevican was detected in immersion fixed rat cortical stem cells differentiated for 7 days by growth factor withdrawal using Sheep Anti-Human/Rat Brevican Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4009) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Brevican was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using Sheep Anti-Human/Rat Brevican Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4009) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuropil. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Publications)
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(40 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Recombinant Human
IGKV1-5 GST (N-Term) ...
H00028299-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Rat tissue extract (50ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody [GT1761] ) diluted at 1:1000.
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - A. 30 ug zebrafish heart lysate/extract 10 % SDS-PAGE Citrate synthetase antibody [GT1761] dilution: 1:1000
Western Blot: CS Citrate Synthase Antibody (1761) [NBP2-43648] - Non-transfected (Negative) and transfected (Positive) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Citrate synthetase antibody diluted at 1:1000. The HRP-conjugated anti-mouse IgG antibody was used to detect the primary antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
ABCB6 Antibody
NBP2-58327
Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, WB
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Tenascin C Antibody (4C8MS) [NB110-68136] - SK-MEL-28 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Tenascin C at 5 ug/ml overnight at 4C and detected with an anti-Mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(2 Reviews)
(25 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug Neuro2A whole cell lysate/extract B. 30 ug C2C12 whole cell lysate/extract 7.5% SDS-PAGE . GALNS antibody dilution: 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract7.5% SDS-PAGE GALNS antibody dilution: 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraformaldehyde-fixed HeLa, using GALNS antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ADAMTS1 Antibody
AF5867
ADAMTS1 was detected in immersion fixed frozen sections of mouse embryo (13 d.p.c.) using Sheep Anti-Human/Mouse ADAMTS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5867) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cartilage primordium; dorsal ganglia cell bodies and processes. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of P19 mouse embryonal carcinoma cell line and OVCAR‑3  human ovarian carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse ADAMTS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5867) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for ADAMTS1 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(7 Publications)
Species: Hu, Mu
Applications: IHC, IP, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(662 Publications)
Species: Hu
Applications: BA
Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Formalin fixed paraffin embedded human kidney stained with Elastin antibody.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Presence of ECM proteins collagen, elastin, fibronectin, vitronectin and GAGs following decellularization. Porcine vena cavas were decellularized and analyzed for ECM proteins. Cross-section of paraffin embedded samples were immunostained for collagen type I/III, elastin, fibronectin and vitronectin. Images were taken at identical microscopy settings. Scale bar is 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0220743), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Formalin fixed paraffin embedded human renal cell carcinoma stained with Elastin antibody (NB100-2076)
(2 Reviews)
(8 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PTP
beta/zeta/PTPRZ Antib
MAB2688
Western blot shows lysates of Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human PTP beta / zeta /PTPRZ Monoclonal Antibody (Catalog # MAB2688) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for PTP beta / zeta /PTPRZ at approximately 250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB
Syndecan-1/CD138
Antibody
AF2780
Syndecan‑1/CD138 was detected in immersion fixed paraffin-embedded sections of human ileum using Human Syndecan‑1/CD138 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2780) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Syndecan‑1/CD138 was detected in immersion fixed paraffin-embedded sections of human jejunum using Human Syndecan‑1/CD138 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2780) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(9 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
SLC25A12 Antibody
NBP1-89020
Western Blot: SLC25A12 Antibody [NBP1-89020] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: SLC25A12 Antibody [NBP1-89020] - Analysis using Anti-SLC25A12 antibody NBP1-89020 (A) shows similar pattern to independent antibody NBP2-38249 (B).
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for Versican Antibody (NBP1-85432)(6)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, IHC-P.


Filter By Application
ICC/IF
(1)
IHC
(2)
IHC-P
(2)
All Applications
Filter By Species
Human
(3)
Mouse
(1)
All Species

Reviews for Versican Antibody (NBP1-85432) (0)

There are no reviews for Versican Antibody (NBP1-85432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Versican Antibody (NBP1-85432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Versican Products

Bioinformatics Tool for Versican Antibody (NBP1-85432)

Discover related pathways, diseases and genes to Versican Antibody (NBP1-85432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Versican Antibody (NBP1-85432)

Discover more about diseases related to Versican Antibody (NBP1-85432).
 

Pathways for Versican Antibody (NBP1-85432)

View related products by pathway.

PTMs for Versican Antibody (NBP1-85432)

Learn more about PTMs related to Versican Antibody (NBP1-85432).
 

Research Areas for Versican Antibody (NBP1-85432)

Find related products by research area.

Blogs on Versican

There are no specific blogs for Versican, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Versican Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol VCAN
Entrez
Uniprot