Versican Antibody

Images

 
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human stomach shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human tonsil shows no positivity as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Versican Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCAN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC reported in scientific literature (PMID: 25593993). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Versican Protein (NBP1-85432PEP)
Publications
Read Publications using
NBP1-85432 in the following applications:

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34178974). Human reactivity reported in scientific literature (PMID: 25593993).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Versican Antibody

  • Chondroitin sulfate proteoglycan 2WGN
  • Chondroitin sulfate proteoglycan core protein 2
  • CSPG2
  • CSPG2DKFZp686K06110
  • ERVR
  • GHAP
  • Glial hyaluronate-binding protein
  • Large fibroblast proteoglycan
  • PG-M
  • PG-MWGN1
  • VCAN
  • versican core protein
  • versican proteoglycan
  • Versican

Background

Versican is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF143
Species: Hu
Applications: IHC, Simple Western, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF2667
Species: Hu
Applications: IHC, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF5800
Species: Mu, Rt
Applications: IHC, WB
AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5867
Species: Hu, Mu
Applications: IHC, IP, WB
236-EG
Species: Hu
Applications: BA
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB2688
Species: Hu
Applications: WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-89020
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for Versican Antibody (NBP1-85432)(6)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, IHC-P.


Filter By Application
ICC/IF
(1)
IHC
(2)
IHC-P
(2)
All Applications
Filter By Species
Human
(3)
Mouse
(1)
All Species

Reviews for Versican Antibody (NBP1-85432) (0)

There are no reviews for Versican Antibody (NBP1-85432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Versican Antibody (NBP1-85432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Versican Products

Bioinformatics Tool for Versican Antibody (NBP1-85432)

Discover related pathways, diseases and genes to Versican Antibody (NBP1-85432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Versican Antibody (NBP1-85432)

Discover more about diseases related to Versican Antibody (NBP1-85432).
 

Pathways for Versican Antibody (NBP1-85432)

View related products by pathway.

PTMs for Versican Antibody (NBP1-85432)

Learn more about PTMs related to Versican Antibody (NBP1-85432).
 

Research Areas for Versican Antibody (NBP1-85432)

Find related products by research area.

Blogs on Versican

There are no specific blogs for Versican, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Versican Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VCAN
Entrez
Uniprot