After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder." >
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. ...read more
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." >
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human B-Cell Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human B-Cell Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. ...read more
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." >
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human Lymph Node using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human Lymph Node using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before ...read more
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." >
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human Hodgkin Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human Hodgkin Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. ...read more
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human stomach shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human tonsil shows no positivity as expected.
Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of ...read more
Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of ...read more
Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for ...read more
Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCAN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Versican Antibody - BSA Free
Chondroitin sulfate proteoglycan 2WGN
Chondroitin sulfate proteoglycan core protein 2
CSPG2
CSPG2DKFZp686K06110
ERVR
GHAP
Glial hyaluronate-binding protein
Large fibroblast proteoglycan
PG-M
PG-MWGN1
VCAN
versican core protein
versican proteoglycan
Versican
Background
Versican is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Versican Antibody - BSA Free and receive a gift card or discount.