We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Versican Antibody - BSA Free

Images

 
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder." > Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # <A class=DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the astrocytes showing cytoplasmic staining. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human brain Glioblastoma using Rabbit Anti-Human Versican Monoclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37 ° Celsius for 8 minutes. ...read more
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." > DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human B-Cell Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human B-Cell Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. ...read more
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." > DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human Lymph Node using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human Lymph Node using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before ...read more
DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." > DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." title="Versican was detected in immersion fixed paraffin-embedded sections of human Hodgkin Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. Before incubation with the primary antibody, tissue underwent an all-in-one dewaxing and antigen retrieval preprocessing using PreTreatment Module (PT Module) and Dewax and HIER Buffer H (pH 9; Epredia Catalog # TA-999-DHBH). Tissue was stained using the Alexa Fluor™ Plus 555 Goat anti-Rabbit IgG Secondary Antibody at 1:100 at 37 ° Celsius for 2 minutes. (Yellow; Lunaphore Catalog # DR555RB) and counterstained with DAPI (blue; Lunaphore Catalog # DR100). Specific staining was localized to the cytoplasm of connective tissue/stroma. Protocol available in COMET™ Panel Builder." />
Versican was detected in immersion fixed paraffin-embedded sections of human Hodgkin Lymphoma using Rabbit Anti-Human/Mouse Versican, Polyclonal Antibody (Catalog # NBP1-85432) at 10ug/mL at 37° Celsius for 8 minutes. ...read more
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human uterine cervix shows strong positivity in the extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human stomach shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Versican Antibody [NBP1-85432] - Staining of human tonsil shows no positivity as expected.
Biological Strategies: nbp1-85432_rabbit-polyclonal-versican-antibody-2552023151495.jpg
Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of ...read more
Treatment of CAFs with combined cytokines or cancer cell-derived secretomes affects ECM protein expression(A) Western blot showing the effects of bFGF, EGF & TGF-beta 1 treatment (10 ng/ml) on the expression of ...read more
Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for ...read more
Immunohistochemistry: Versican Antibody [NBP1-85432] - Immunohistochemical staining of stromal protein expression in DCIS with sclerotic or myxoid stromaMicrophotographs displaying HE staining (A-B), & IHC staining for ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, COMET, mIF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
   

Biological Strategies

     

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Versican Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VCAN
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • COMET
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Multiplex Immunofluorescence 10ug/mL
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Versican Protein (NBP1-85432PEP)
Publications
Read Publications using
NBP1-85432 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Versican Antibody - BSA Free

  • Chondroitin sulfate proteoglycan 2WGN
  • Chondroitin sulfate proteoglycan core protein 2
  • CSPG2
  • CSPG2DKFZp686K06110
  • ERVR
  • GHAP
  • Glial hyaluronate-binding protein
  • Large fibroblast proteoglycan
  • PG-M
  • PG-MWGN1
  • VCAN
  • versican core protein
  • versican proteoglycan
  • Versican

Background

Versican is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1060
Species: Mu
Applications: ELISA(Cap), ELISA(Det), IHC, Simple Western, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2667
Species: Hu
Applications: IHC, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
AF5800
Species: Mu, Rt
Applications: IHC, WB
AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF5867
Species: Hu, Mu
Applications: IHC, IP, WB
236-EG
Species: Hu
Applications: BA
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB2688
Species: Hu
Applications: WB
NB100-64980
Species: Hu
Applications: Flow, Func, IHC, IHC-Fr,  IHC-P, WB
NBP1-89020
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for Versican Antibody (NBP1-85432)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: FLOW, ICC/IF, IF/IHC, IHC-P.


Filter By Application
FLOW
(1)
ICC/IF
(1)
IF/IHC
(2)
IHC-P
(2)
All Applications
Filter By Species
Human
(4)
Mouse
(1)
All Species
Showing Publications 1 - 7 of 7.
Publications using NBP1-85432 Applications Species
Li J, Sina AAI, Antaw F et al. Digital Decoding of Single Extracellular Vesicle Phenotype Differentiates Early Malignant and Benign Lung Lesions Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2022-11-17 [PMID: 36394090] (FLOW, Human) FLOW Human
Ghorbani S, Jelinek E, Jain R et al. Versican promotes T helper 17 cytotoxic inflammation and impedes oligodendrocyte precursor cell remyelination Nature communications 2022-05-04 [PMID: 35508608] (ICC/IF, IHC-P, Human) ICC/IF, IHC-P Human
Yoshioka H, Suzuki A, Iwaya C, Iwata J Suppression of microRNA 124-3p and microRNA 340-5p ameliorates retinoic acid-induced cleft palate in mice Development (Cambridge, England) 2022-05-01 [PMID: 35420127]
Yoshioka H, Mikami Y, Ramakrishnan SS et al. MicroRNA-124-3p Plays a Crucial Role in Cleft Palate Induced by Retinoic Acid Frontiers in cell and developmental biology 2021-06-09 [PMID: 34178974] (IHC-P, Mouse) IHC-P Mouse
Cai WY, Dong ZN, Fu XT et al. Identification of a Tumor Microenvironment-relevant Gene set-based Prognostic Signature and Related Therapy Targets in Gastric Cancer Theranostics 2020-07-09 [PMID: 32754268] (IF/IHC, Human) IF/IHC Human
Yang Z, Ma S, Cao R et al. CD49fhigh Defines A Distinct Skin Mesenchymal Stem Cell Population Capable of Hair Follicle Epithelial Cell Maintenance J. Invest. Dermatol. 2019-09-05 [PMID: 31494092]
Van Bockstal M, Lambein K, Van Gele M et al. Differential regulation of extracellular matrix protein expression in carcinoma-associated fibroblasts by TGF--beta1 regulates cancer cell spreading but not adhesion. Oncoscience 2014-01-01 [PMID: 25593993] (IF/IHC, Human) IF/IHC Human

Reviews for Versican Antibody (NBP1-85432) (0)

There are no reviews for Versican Antibody (NBP1-85432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Versican Antibody (NBP1-85432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Versican Products

Research Areas for Versican Antibody (NBP1-85432)

Find related products by research area.

Blogs on Versican

There are no specific blogs for Versican, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Versican Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol VCAN
Entrez
Uniprot