SLC25A12 Antibody

Images

 
Independent Antibodies: Western Blot: SLC25A12 Antibody [NBP1-89020] - Analysis using Anti-SLC25A12 antibody NBP1-89020 (A) shows similar pattern to independent antibody NBP2-38249 (B).
Immunohistochemistry: SLC25A12 Antibody [NBP1-89020] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Western Blot: SLC25A12 Antibody [NBP1-89020] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

SLC25A12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A12 Protein (NBP1-89020PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A12 Antibody

  • AGC1
  • araceli hiperlarga
  • ARALAR
  • ARALAR1
  • calcium binding mitochondrial carrier superfamily member Aralar1
  • calcium-binding mitochondrial carrier protein Aralar1
  • Mitochondrial aspartate glutamate carrier 1
  • solute carrier family 25 (mitochondrial carrier, Aralar), member 12
  • Solute carrier family 25 member 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF3054
Species: Hu
Applications: ICC, IHC, WB
NBP1-33380
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF143
Species: Hu
Applications: IHC, Simple Western, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB
NB600-844
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
DM1300
Species: Hu
Applications: ELISA
DY4307-05
Species: Hu
Applications: ELISA
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF5800
Species: Mu, Rt
Applications: IHC, WB
AF4009
Species: Hu, Rt
Applications: ICC, IHC, IP, WB
AF2667
Species: Hu
Applications: IHC, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
DY2198-05
Species: Hu
Applications: ELISA
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC25A12 Antibody (NBP1-89020) (0)

There are no publications for SLC25A12 Antibody (NBP1-89020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A12 Antibody (NBP1-89020) (0)

There are no reviews for SLC25A12 Antibody (NBP1-89020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A12 Antibody (NBP1-89020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC25A12 Products

Bioinformatics Tool for SLC25A12 Antibody (NBP1-89020)

Discover related pathways, diseases and genes to SLC25A12 Antibody (NBP1-89020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A12 Antibody (NBP1-89020)

Discover more about diseases related to SLC25A12 Antibody (NBP1-89020).
 

Pathways for SLC25A12 Antibody (NBP1-89020)

View related products by pathway.

PTMs for SLC25A12 Antibody (NBP1-89020)

Learn more about PTMs related to SLC25A12 Antibody (NBP1-89020).

Blogs on SLC25A12

There are no specific blogs for SLC25A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A12
Entrez
Uniprot