SLC25A12 Antibody

Images

 
Western Blot: SLC25A12 Antibody [NBP1-89020] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.
Western Blot: SLC25A12 Antibody [NBP1-89020] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC25A12 Protein (NBP1-89020PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC25A12 Antibody

  • AGC1
  • araceli hiperlarga
  • ARALAR
  • ARALAR1
  • calcium binding mitochondrial carrier superfamily member Aralar1
  • calcium-binding mitochondrial carrier protein Aralar1
  • Mitochondrial aspartate glutamate carrier 1
  • solute carrier family 25 (mitochondrial carrier, Aralar), member 12
  • Solute carrier family 25 member 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF3075
Species: Hu
Applications: WB, ICC
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
355-BM/CF
Species: Hu, Mu, Rt
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5800
Species: Mu, Rt
Applications: WB, IHC
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
AF2667
Species: Hu
Applications: WB, IHC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC25A12 Antibody (NBP1-89020) (0)

There are no publications for SLC25A12 Antibody (NBP1-89020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A12 Antibody (NBP1-89020) (0)

There are no reviews for SLC25A12 Antibody (NBP1-89020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A12 Antibody (NBP1-89020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A12 Products

Bioinformatics Tool for SLC25A12 Antibody (NBP1-89020)

Discover related pathways, diseases and genes to SLC25A12 Antibody (NBP1-89020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A12 Antibody (NBP1-89020)

Discover more about diseases related to SLC25A12 Antibody (NBP1-89020).
 

Pathways for SLC25A12 Antibody (NBP1-89020)

View related products by pathway.

PTMs for SLC25A12 Antibody (NBP1-89020)

Learn more about PTMs related to SLC25A12 Antibody (NBP1-89020).

Blogs on SLC25A12

There are no specific blogs for SLC25A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A12
Entrez
Uniprot