VEGFR2/KDR/Flk-1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit VEGFR2/KDR/Flk-1 Antibody - BSA Free (NBP3-25223) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein VEGFR2/KDR/Flk-1 using the following amino acid sequence: TARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KDR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VEGFR2/KDR/Flk-1 Antibody - BSA Free
Background
Vascular endothelial growth factor receptor 2 (VEGFR2) is a member of a receptor tyrosine kinase family whose activation plays an essential role in a large number of biological processes such as embryonic development, wound healing, cell proliferation, migration and differentiation. Like other common growth factor receptors, VEGF receptor 2 dimerises upon ligand binding and is autophosphorylated at multiple tyrosine residues. These sites can be involved in the regulation of kinase activity or can serve as binding sites for SH2 and phosphotyrosine binding containing signaling proteins. Phosphorylation of Tyrosines 1054 and 1059 in the activation loop is required for activation of VEGF receptor 2 and its intrinsic tyrosine kinase activity.
Defects in the VEGFR2 gene are associated with susceptibility to benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium called hemangioma capillary infantile. HCI is the most common tumor found in infants, found in up to 10% of all births.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Hu
Applications: ICC/IF
Publications for VEGFR2/KDR/Flk-1 Antibody (NBP3-25223) (0)
There are no publications for VEGFR2/KDR/Flk-1 Antibody (NBP3-25223).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VEGFR2/KDR/Flk-1 Antibody (NBP3-25223) (0)
There are no reviews for VEGFR2/KDR/Flk-1 Antibody (NBP3-25223).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VEGFR2/KDR/Flk-1 Antibody (NBP3-25223) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VEGFR2/KDR/Flk-1 Products
Research Areas for VEGFR2/KDR/Flk-1 Antibody (NBP3-25223)
Find related products by research area.
|
Blogs on VEGFR2/KDR/Flk-1