VEGFR1/Flt-1 Antibody (CL0345)

Images

 
Western Blot: VEGFR1/Flt-1 Antibody (CL0345) [NBP2-30982] - Lane 1: Marker [kDa] Lane 2: Human cell line RT-4
Immunohistochemistry: VEGFR1/Flt-1 Antibody (CL0345) [NBP2-30982] - Immunohistochemical staining of human kidney shows immunoreactivity in the endothelium and smooth muscle cells of blood vessels, as well as in renal ...read more
Immunohistochemistry: VEGFR1/Flt-1 Antibody (CL0345) [NBP2-30982] - Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in the endothelial cells.
Immunohistochemistry: VEGFR1/Flt-1 Antibody (CL0345) [NBP2-30982] - Immunohistochemical staining of human small intestine shows strong positivity in the endothelial cells and smooth muscle cells.
Immunohistochemistry: VEGFR1/Flt-1 Antibody (CL0345) [NBP2-30982] - Immunohistochemical staining of human cerebellum shows positivity in the endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clone
CL0345
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VEGFR1/Flt-1 Antibody (CL0345) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGS
Marker
Endothelial Cell Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
FLT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for VEGFR1/Flt-1 Antibody (CL0345)

  • EC 2.7.10
  • EC 2.7.10.1
  • FLT
  • FLT1
  • Flt-1
  • Fms-like tyrosine kinase 1
  • fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascularpermeability factor receptor)
  • FRT
  • Tyrosine-protein kinase FRT
  • Tyrosine-protein kinase receptor FLT
  • vascular endothelial growth factor receptor 1
  • Vascular permeability factor receptor
  • VEGF R1
  • VEGFR1
  • VEGFR-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA

Publications for VEGFR1/Flt-1 Antibody (NBP2-30982) (0)

There are no publications for VEGFR1/Flt-1 Antibody (NBP2-30982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VEGFR1/Flt-1 Antibody (NBP2-30982) (0)

There are no reviews for VEGFR1/Flt-1 Antibody (NBP2-30982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VEGFR1/Flt-1 Antibody (NBP2-30982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VEGFR1/Flt-1 Products

Bioinformatics Tool for VEGFR1/Flt-1 Antibody (NBP2-30982)

Discover related pathways, diseases and genes to VEGFR1/Flt-1 Antibody (NBP2-30982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VEGFR1/Flt-1 Antibody (NBP2-30982)

Discover more about diseases related to VEGFR1/Flt-1 Antibody (NBP2-30982).
 

Pathways for VEGFR1/Flt-1 Antibody (NBP2-30982)

View related products by pathway.

PTMs for VEGFR1/Flt-1 Antibody (NBP2-30982)

Learn more about PTMs related to VEGFR1/Flt-1 Antibody (NBP2-30982).
 

Research Areas for VEGFR1/Flt-1 Antibody (NBP2-30982)

Find related products by research area.

Blogs on VEGFR1/Flt-1

There are no specific blogs for VEGFR1/Flt-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VEGFR1/Flt-1 Antibody (CL0345) and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT1
Entrez
Uniprot