VEGFR1/Flt-1 Antibody (7F1A3) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1/Flt-1 (P17948). MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
FLT1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for VEGFR1/Flt-1 Antibody (7F1A3)
Background
Receptors for VEGF, VEGFB and PGF have tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. VEGF and its high-affinity binding receptors--the tyrosine kinases FLK1 and FLT1--are thought to be important for the development of embryonic vasculature. It has been shown that an alternately spliced form of FLT1 produces a soluble protein, termed sFLT1, which binds vascular endothelial growth factor with high affinity, playing an inhibitory role in angiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Block, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Publications for VEGFR1/Flt-1 Antibody (NBP3-15683) (0)
There are no publications for VEGFR1/Flt-1 Antibody (NBP3-15683).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VEGFR1/Flt-1 Antibody (NBP3-15683) (0)
There are no reviews for VEGFR1/Flt-1 Antibody (NBP3-15683).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VEGFR1/Flt-1 Antibody (NBP3-15683) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VEGFR1/Flt-1 Products
Research Areas for VEGFR1/Flt-1 Antibody (NBP3-15683)
Find related products by research area.
|
Blogs on VEGFR1/Flt-1